KEGG   Clavibacter michiganensis subsp. insidiosus: VO01_12870Help
Entry
VO01_12870        CDS       T03862                                 

Definition
(GenBank) phosphate import ATP-binding protein PstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
cmh  Clavibacter michiganensis subsp. insidiosus
Pathway
cmh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cmh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    VO01_12870
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmh02000]
    VO01_12870
Enzymes [BR:cmh01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     VO01_12870
Transporters [BR:cmh02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    VO01_12870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_15 RsgA_GTPase AAA_29 AAA_33 Rad17 AAA_30 AAA_23 AAA_18 AAA_16 PRK Adeno_IVa2 AAA_28 RNA_helicase AAA_24 G-alpha AAA_13
Motif
Other DBs
NCBI-ProteinID: AJW79899
UniProt: A0A0D5CKR6
LinkDB All DBs
Position
2731703..2732482
Genome map
AA seq 259 aa AA seqDB search
MSKSIEVNDLNVYYGKFKAVEDVNLRIEPRTVTAFIGPSGCGKSTFLRTLNRMHEVIPGA
YVEGEVLVDGNDLYGPGVDPVLVRRQVGMVFQRPNPFPTMSIRDNVLAGVKLNNRKISKS
DADALVEQSLMGANLWNEVKDRLALPGSGLSGGQQQRLCIARAIAVQPDVVLMDEPCSAL
DPISTLAIEDLIEELKAQYTIVIVTHNMQQASRVSDRTAFFNIAGTGKPGKLIEYDDTTT
MFSKPSVQATEDYVSGRFG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttgtccaagagcatcgaagtcaacgacctgaacgtctactacggcaagttcaaggccgtc
gaggacgtcaacctgcggatcgagccgcgcaccgtcacggcgttcatcggcccgtccggc
tgcggcaagtcgaccttcctccgcacgctgaaccgcatgcacgaggtgatccccggcgcg
tacgtcgagggcgaggtgctggtcgacggcaacgacctctacggccccggcgtcgacccg
gtgctcgtgcgccgccaggtcggcatggtcttccagcggccgaacccgttccccaccatg
tcgatccgcgacaacgtgctggcgggcgtgaagctcaacaaccggaagatctccaagtcg
gacgcggacgccctcgtcgagcagtcgctcatgggcgccaacctctggaacgaggtcaag
gaccgcctcgcgctgccgggatccggcctctcgggcggccagcagcagcgcctctgcatc
gcgcgcgccatcgcggtgcagcccgacgtggtgctgatggacgagccgtgctccgcgctc
gaccccatctccacgctcgccatcgaggacctcatcgaggagctcaaggcgcagtacacg
atcgtgatcgtgacccacaacatgcagcaggccagccgcgtctccgaccgcacggccttc
ttcaacatcgccggcaccggcaagcccggcaagctcatcgagtacgacgacaccaccacc
atgttctcgaagcccagcgtgcaggcgaccgaggactacgtcagcggccgcttcggctga

DBGET integrated database retrieval system