KEGG   Clavibacter michiganensis subsp. insidiosus: VO01_13035Help
Entry
VO01_13035        CDS       T03862                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cmh  Clavibacter michiganensis subsp. insidiosus
Pathway
cmh00020  Citrate cycle (TCA cycle)
cmh00480  Glutathione metabolism
cmh01100  Metabolic pathways
cmh01110  Biosynthesis of secondary metabolites
cmh01120  Microbial metabolism in diverse environments
cmh01130  Biosynthesis of antibiotics
cmh01200  Carbon metabolism
cmh01210  2-Oxocarboxylic acid metabolism
cmh01230  Biosynthesis of amino acids
Module
cmh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VO01_13035
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VO01_13035
Enzymes [BR:cmh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     VO01_13035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP ART-PolyVal
Motif
Other DBs
NCBI-ProteinID: AJW79924
UniProt: A0A0D5CKU0
LinkDB All DBs
Position
complement(2768609..2769823)
Genome map
AA seq 404 aa AA seqDB search
MEKIKVEGTVVELDGDEMTRIIWQSIKDTLIHPYLDIDLEYYDLGIEKRDETDDQITIDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFREPIIISNIPRL
VPGWNKPIIVGRHAFGDQYRATDFRFEGEGTLTMTFTPKDGSEPQQFEVFQSPGSGVAMG
MYNLDDSIRDFARASLSYGLARNYPVYLSTKNTILKAYDGRFKDLFQEVFEAEYKEQFDA
AGLTYEHRLIDDMVAASLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLTTPDGK
VVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLAHRAKLDGNDALKTFADTLED
VVITTVESGKMTKDLALLVGPDQPYQTTEEFLASLADNLQTRLA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggagaagatcaaggtagaggggaccgtcgtcgagctcgacggcgacgagatgacgcgc
atcatctggcagtccatcaaggacacgctcatccacccgtacctcgacatcgacctcgag
tactacgacctgggcatcgagaagcgcgacgagaccgacgaccagatcacgatcgacgcg
gcgaacgccatcaagaagcacggcgtcggcgtcaagtgcgcgacgatcacgcccgacgag
gcgcgcgtcgaggagttcggcctgaagaagatgtggcgctcgccgaacggcaccatccgc
aacatcctgggcggcacgatcttccgcgagcccatcatcatcagcaacatcccgcgcctc
gtgcccggctggaacaagccgatcatcgtcggccgccacgcgttcggcgaccagtaccgc
gccaccgacttccgcttcgagggcgagggcacgctcacgatgaccttcacgccgaaggac
ggctcggagccgcagcagttcgaggtgttccagagccccggatccggcgtcgcgatgggc
atgtacaacctcgacgactcgatccgcgacttcgcgcgcgcgtcgctctcgtacggcctc
gcccggaactaccccgtctacctctccaccaagaacacgatcctcaaggcctacgacggc
cgcttcaaggacctgttccaggaggtcttcgaggccgagtacaaggagcagttcgacgcc
gcgggcctcacctacgagcaccgcctcatcgacgacatggtcgccgcctcgctcaagtgg
gagggcggctacgtctgggcgtgcaagaactacgacggcgacgtgcagtccgacaccgtc
gcgcagggcttcggctcgctcggcctcatgacgagcgtgctcaccacgcccgacggcaag
gtcgtcgaggcggaggccgcgcacggcaccgtcacgcgccactaccgccagcaccagcag
ggcaagcccacctcgacgaaccccatcgcgtcgatctacgcctggacccgtggcctcgcg
caccgcgccaagctcgacggcaacgacgcgctgaagacgttcgcggacaccctcgaggac
gtcgtcatcacgacggtcgagagcggcaagatgacgaaggacctcgcgctcctcgtcggc
ccggaccagccgtaccagacgaccgaggagttcctcgcgtcgctcgcggacaacctgcag
acgcgcctggcctga

DBGET integrated database retrieval system