KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2074Help
Entry
CMM_2074          CDS       T00529                                 

Definition
(GenBank) conserved hypothetical protein/ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cmi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CMM_2074
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cmi03400]
    CMM_2074
Enzymes [BR:cmi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CMM_2074
DNA repair and recombination proteins [BR:cmi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CMM_2074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: CAN02137
UniProt: A5CSR6
LinkDB All DBs
Position
2338121..2340619
Genome map
AA seq 832 aa AA seqDB search
MEVDGHRIALTNLDKVLYPATGTTKGDVIAYYAAIAPHMLPHLRDRPVTRKRWVDGVGTD
EAPGKMFFQKDLDAHTPEWVQRRAIQHRDHANDYPLVGDVATLTWLGQIAALELHVPQWR
FGRTGDERRPDRLVLDLDPGPGAGLPECVEVAKAARAILRDMGLEPYPVTSGSKGIHLYA
ALDGSHDASRVSEVAHELARALEADHPDLVVSDMKKALREGKVLVDWSQNNPNKTTVAPY
SLRGRSRPTVAVPRTWRELSSPTLLHLELDEVIARMRRRADPLAPVEEGHRESLEPTRER
LAGFARKEPAADADGADDRLATYRSKRDAAKTSEPVPAESPAPSEGSTFVIQEHHARALH
WDFRLEHDGVLVSWALPKGVPTEHGTNHLAVQTEDHPLEYGSFEGTIPAGEYGGGEVTIW
DAGTFELEKWRDGEEVIATLHGRGDGTGIDGPRRYALIHTGGHGKVDANWLIHLMEPADA
PATARAKPTRPASLEKAGGRTRVGARRKGGAASAPAPMLATAATAAGLDADEEWAVEMKW
DGYRAIAVVADGRATITSRNGVDLTPAFPELADLPDSLDVDAAVLDGEIVVLGDGGHPDF
GLLQTRLGLTGEKEIARARKAAPVHLMLFDALAIGDRVLVEEPYRDRRAALLDAVRSPGR
GRIQVPPAFDGDLGGALATSRELGLEGVVAKRVDAPYESGRRSSAWIKIKHHRAQEVVVG
GWRPGSGSRASGIGSLLVGVPGPDGLEYAGRVGTGFTERDLADALRRFGPLARKTSPFAD
VPAADARDAHWITPRLVGEVEFAEWTSTGRLRQASWRGWRHDKSSDEVVRED
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
gtggaggtcgacgggcaccggatcgcgctcacgaacctcgacaaggtgctgtacccggcg
accggcacgaccaagggcgacgtcatcgcctactacgcggccatcgcgccgcacatgctg
ccgcacctccgcgaccggcccgtgacccgcaagcgctgggtcgacggcgtgggcaccgac
gaggcgccggggaagatgttcttccagaaggacctcgacgcgcacacgccggagtgggtg
cagcggcgggcgatccagcacagggaccacgcgaacgactacccgctcgtcggggacgtc
gcgacgctcacctggctcgggcagatcgcggcgctcgagctgcacgtgccgcagtggcgg
ttcggccgcacgggcgacgagcggcgccccgaccggctcgtgctggacctcgacccgggc
ccgggcgccggcctccccgagtgcgtggaggtcgcgaaggccgcacgggcgatcctccgc
gacatgggcctcgagccgtaccccgtgacgagcgggtccaagggcatccacctctacgcc
gcgctcgacggcagccacgacgcctctcgcgtctccgaggtcgcgcacgagctggcccgc
gccctcgaggccgaccaccccgatctcgtcgtgagcgacatgaagaaggcgctgcgcgag
ggcaaggtgctcgtcgactggagccagaacaacccgaacaagacgaccgtcgcgccctac
tcgctgcgcggccgctcccggccgaccgtcgcggtgccgcgcacctggcgggagctgtcg
tcgccgacgctcctgcacctggagctggacgaggtgatcgcgcggatgcgcaggcgcgcg
gatccgctcgcccccgtcgaggagggccaccgcgagagcctggagccgacgcgggagcgg
ctcgcgggcttcgcgcggaaggagcccgccgccgacgcggacggcgccgacgaccggctc
gcgacctaccggtccaagcgcgacgccgcgaagaccagcgagccggtgcccgcggagtcc
cccgcgccctcggagggcagcaccttcgtgatccaggagcaccacgcccgcgcgctgcac
tgggacttccggctcgagcacgacggcgtgctcgtgagctgggccctccccaagggcgtg
cccaccgagcacggcacgaaccacctcgcggtgcagaccgaggaccacccgctcgagtac
ggatccttcgagggcacgatccccgcgggcgagtacggcggcggcgaggtcaccatctgg
gacgcgggcaccttcgagctggagaagtggcgcgacggcgaggaggtcatcgcgacgctg
cacggccgcggcgacggcaccggcatcgacgggccgcgacggtacgcgctcatccacacg
ggcggccacggcaaggtcgacgcgaactggctcatccacctgatggagccggcggacgcg
cccgcgacggcgcgcgcgaagccgacccgccccgcatcgctcgagaaggcgggcggccgc
acgcgcgtcggcgcgcggcggaagggcggcgccgcgtccgcccccgcgcccatgctcgcc
acggccgcgaccgccgccggcctcgacgccgacgaggagtgggcggtcgagatgaagtgg
gacggctaccgcgccatcgccgtcgtcgccgacggccgggcgaccatcacgagccgcaac
ggcgtcgacctcacgcccgccttccccgagctcgccgacctgcccgactccctcgacgtc
gacgccgccgtgctcgacggcgagatcgtggtgctgggcgacggcggccaccccgacttc
ggactcctgcagacgcgcctcgggctcacgggcgagaaggagatcgcgcgcgcccggaag
gccgcgcccgtgcacctcatgctcttcgacgcgctcgcgatcggcgaccgcgtgctcgtc
gaggagccctaccgggatcgccgtgccgcgctcctcgacgccgtccggtcgccgggccgc
gggcggatccaggtcccgcccgccttcgacggcgacctcggcggggcgctcgccaccagc
cgggagctcggcctcgagggcgtcgtcgccaagcgcgtcgacgcgccctacgagtcgggc
cggcggtcgagcgcctggatcaagatcaagcaccaccgggcgcaggaggtcgtggtcggg
ggctggcggcccggatccggcagccgggcatccggcatcggctcgctgctggtcggcgtc
cccggccccgacggcctggagtacgcgggccgcgtcggcacgggcttcaccgagcgcgac
ctcgccgacgcgctccgccgcttcggcccgctcgcgcggaagacgagcccgttcgcggac
gtgcccgccgccgacgcccgcgacgcgcactggatcaccccgcgtctcgtcggcgaggtc
gagttcgccgagtggacctcgacgggccgcctccgccaggcgtcgtggcgcggctggcgg
cacgacaagtcatccgacgaggtcgtccgcgaggactga

DBGET integrated database retrieval system