KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2158Help
Entry
CMM_2158          CDS       T00529                                 

Gene name
pknF
Definition
(GenBank) putative serine/threonine protein kinase
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Pkinase_fungal YSIRK_signal
Motif
Other DBs
NCBI-ProteinID: CAN02228
UniProt: A5CT03
LinkDB All DBs
Position
2438004..2439254
Genome map
AA seq 416 aa AA seqDB search
MPGERPDPLAGTLLAGRYRISGLLGRGGMATVYRAADETLGREVAVKVFATDSADPGEVE
RQEGEVRMLAGLSHPGLVTLFDVGDDVVADRVLAFIVMEIVDGSTLADRMKEGPLPGPEV
ARIGGILSDALGYIHRRGVVHRDVKPANVLLARPEDDDEPAVAKLTDFGIARLVDGTRLT
STGSIIGTVSYLSPEQALGEEVGAPTDVYALGLVLLECLTGRRTFPGTAAESTMARVVRD
PEIPARLGASWVDLLSRMTRRDPATRPTAREVAAELRTGRAPESAVDAPTATSTRVMPAA
AAAGLGAAGAGAAAAPFADPDARTERFAAAPTTPPARGADPTARTSPAADADRAPAKRRG
NRALSIGVVSVLIAAAAVVGVVTVNAMQTHDTSYPSVPGPLGASLEELQKSVEDAP
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcccggagaacggcccgacccactcgccggcacgctgctggccggtcgctaccgcatc
agcgggctgctcggacgcggcggcatggccaccgtgtaccgcgccgccgacgagacgctc
ggccgcgaggtggccgtcaaggtcttcgcgaccgactccgccgatcccggcgaggtcgag
cgccaggagggcgaggtgcgcatgctcgcgggcctcagccaccccggcctcgtgacgctc
ttcgacgtgggcgacgacgtcgtcgccgaccgcgtgctcgcgttcatcgtgatggagatc
gtcgacggctcgacgctcgccgaccgcatgaaggaggggccgctgcccgggcccgaggtg
gcgcgcatcggcgggatcctcagcgacgcgctcggctacatccaccgtcgcggcgtcgtg
caccgcgacgtgaagcccgccaacgtgctgctggcgcggcccgaggacgacgacgagccg
gcggtcgccaagctcaccgacttcggcatcgcccggctcgtggacggcacgcgcctcacg
tcgaccggatccatcatcggcaccgtcagctacctcagccccgagcaggcgctcggcgag
gaggtcggcgcgcccaccgacgtgtacgcgctcggcctcgtgctcctcgagtgcctcacc
ggccgtcgcaccttcccgggcacggccgcggagtcgaccatggcgcgcgtggtgcgcgac
ccggagatcccggcccggctcggcgcatcgtgggtggacctcctctcccgcatgacccgc
cgcgatcccgcgacccggccgaccgcgcgcgaggtcgccgcggagctccggaccggacgc
gcgccggagtccgcggtggacgcgccgaccgccacctcgacgcgggtgatgcccgctgcg
gccgctgccgggctcggcgcggccggggcgggtgctgctgctgcgccgttcgcggatccg
gacgcccggaccgagcggttcgccgccgcgccgacgactcctcccgcgcgcggcgcggac
cccaccgccaggacctccccggccgccgacgcggatcgtgccccggcgaagcgccgcggc
aaccgggcgctcagcatcggcgtcgtgtccgtgctgatcgccgcggccgccgtcgtgggc
gtcgtgaccgtcaacgccatgcagacccacgacacctcgtacccgtccgtccccggaccc
ctcggcgccagcctcgaggagctgcagaagagcgtggaggacgccccgtga

DBGET integrated database retrieval system