KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2537Help
Entry
CMM_2537          CDS       T00529                                 

Gene name
icdA
Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00020  Citrate cycle (TCA cycle)
cmi00480  Glutathione metabolism
cmi01100  Metabolic pathways
cmi01110  Biosynthesis of secondary metabolites
cmi01120  Microbial metabolism in diverse environments
cmi01130  Biosynthesis of antibiotics
cmi01200  Carbon metabolism
cmi01210  2-Oxocarboxylic acid metabolism
cmi01230  Biosynthesis of amino acids
Module
cmi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CMM_2537 (icdA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CMM_2537 (icdA)
Enzymes [BR:cmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CMM_2537 (icdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: CAN02619
UniProt: A5CU33
LinkDB All DBs
Position
complement(2859432..2860646)
Genome map
AA seq 404 aa AA seqDB search
MEKIKVEGTVVELDGDEMTRIIWQSIKDTLIHPYLDIDLEYYDLGIEKRDETDDQITIDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFREPIIISNIPRL
VPGWNKPIIVGRHAFGDQYRATDFRFEGEGTLTMTFTPKDGSEPQQFEVFQSPGSGVAMG
MYNLDDSIRDFARASLSYGLARNYPVYLSTKNTILKAYDGRFKDLFQEVFEAEYADQFAA
AGLTYEHRLIDDMVAASLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLTTPDGK
VVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLAHRAKLDGNDALKTFADTLED
VVITTVESGKMTKDLALLVGPDQPYQTTEEFLASLAENLQTRLA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggagaagatcaaggtagaggggaccgtcgtcgagctcgacggcgacgagatgacgcgc
atcatctggcagtccatcaaggacacgctcatccacccgtacctcgacatcgacctcgag
tactacgacctgggcatcgagaagcgcgacgagaccgacgaccagatcacgatcgacgcc
gccaacgccatcaagaagcacggcgtcggcgtcaagtgcgcgaccatcacgcccgacgag
gcgcgcgtcgaggagttcggcctcaagaagatgtggcgctcgccgaacggcaccatccgc
aacatcctgggcggcacgatcttccgcgagcccatcatcatcagcaacatcccgcgcctc
gtgcccggctggaacaagccgatcatcgtcggccgccacgcgttcggcgaccagtaccgc
gccaccgacttccgcttcgagggcgagggcacgctcacgatgaccttcacgcccaaggac
ggctccgagccgcagcagttcgaggtgttccagagccccggatccggtgtcgcgatgggc
atgtacaacctcgacgactcgatccgcgacttcgcgcgcgcgtcgctctcgtacggcctc
gcccggaactaccccgtgtacctctccacgaagaacacgatcctcaaggcctacgacggc
cgcttcaaggacctgttccaggaggtcttcgaggccgagtacgccgaccagttcgccgca
gccggcctcacctacgagcaccgcctcatcgacgacatggtcgccgcctcgctcaagtgg
gagggcggctacgtctgggcctgcaagaactacgacggcgacgtgcagtcggacaccgtc
gcgcagggcttcggctcgctcggcctcatgaccagcgtgctcaccacgcccgacggcaag
gtcgtcgaggcggaggccgcgcacggcaccgtcacgcgccactaccgccagcaccagcag
ggcaagcccacgtcgacgaacccgatcgcgtcgatctacgcctggacgcggggcctcgcg
caccgcgccaagctcgacgggaacgacgcgctgaagaccttcgcggacaccctcgaggac
gtcgtcatcacgacggtcgagagcggcaagatgacgaaggacctcgcgctcctcgtcgga
ccggaccagccgtaccagacgaccgaggagttcctcgcgtcgctcgcggagaacctgcag
acgcgcctggcctga

DBGET integrated database retrieval system