KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2970Help
Entry
CMM_2970          CDS       T00529                                 

Gene name
ddlB
Definition
(GenBank) putative D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00473  D-Alanine metabolism
cmi00550  Peptidoglycan biosynthesis
cmi01100  Metabolic pathways
cmi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cmi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CMM_2970 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CMM_2970 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CMM_2970 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cmi01011]
    CMM_2970 (ddlB)
Enzymes [BR:cmi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CMM_2970 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:cmi01011]
 Precursor biosynthesis
  Amino acid ligase
   CMM_2970 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 TTL ATP-grasp_4 ATPgrasp_YheCD CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAN03057
UniProt: A5CVB8
LinkDB All DBs
Position
3290873..3291838
Genome map
AA seq 321 aa AA seqDB search
MTAHEPLSVLVLAGGISHERDVSLRSGRRVADALRAAGVQASLRDPDATLLDFLRDTPPA
VVWPVLHGASGEDGALLGLLELAGVPYVGSSARSARLAWDKPTAKAIAESAGIRTPRSVT
LPKDTFRELGAAAVLRLVTEAVPAPYAVKPARGGSAQGVTIVTDAEALPRAMVDAYTYGD
VALIEQLVEGTEVAIGILDTGDGPEALPATEIVPTSGVYGYEARYNAGLTRFFTPARISP
DANAAASAAAIGIHRALGIGQMSRVDIIIDAAGEPWFIEVNVIPGLTETSLLPQGLAAAG
VEVGDLYRRLAEAARGASSGP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacacgagcccctctccgtcctcgtcctcgcgggcgggatctcccatgagcgc
gacgtgtcgctccgcagcggtcgccgcgtggccgacgccttgcgcgcggccggtgtccag
gcgtccctccgcgatcccgacgccacgctcctcgacttcctccgggacacccctcccgcc
gtcgtctggccggtcctccacggggccagcggcgaggacggcgcgctcctcggactgctc
gagctcgcgggcgtcccctacgtgggctcctcggcccgatccgcacgtctcgcgtgggac
aagccgaccgcgaaggccatcgccgaatctgcgggcatccgcacgccacgatccgtgacc
ctgcccaaggacacgttccgcgagctcggcgccgcggccgtcctgcgcctcgtcaccgaa
gccgtgccggccccctacgccgtcaagccggcccgaggcgggtcagcccagggggtcacg
atcgtgaccgacgccgaggccctgccgcgggcgatggtggacgcgtacacctacggcgac
gtcgccctcatcgagcagctcgtcgagggcaccgaggtcgcgatcggcatcctcgacacc
ggcgacggccccgaggcgctgccggcgacggagatcgtcccgacttccggcgtgtacggc
tacgaggcgcgctacaacgcgggactcacgcgcttcttcacccccgcgcgcatctccccc
gacgcgaacgccgcggcctctgcggcggccatcgggatccaccgcgctctcggcatcgga
cagatgtcgcgagtcgacatcatcatcgacgccgcgggcgagccctggttcatcgaggtc
aatgtcatcccgggtctcaccgagacgtcgctgctcccgcagggactcgccgctgctggg
gtcgaggtgggcgatctctaccgccgcctcgccgaggccgcgcggggagcctcctccggc
ccctga

DBGET integrated database retrieval system