KEGG   Candidatus Mikella endobia: PMARG_ME00134Help
Entry
PMARG_ME00134     CDS       T04510                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cmik  Candidatus Mikella endobia
Pathway
cmik00061  Fatty acid biosynthesis
cmik00780  Biotin metabolism
cmik01100  Metabolic pathways
cmik01130  Biosynthesis of antibiotics
cmik01212  Fatty acid metabolism
Module
cmik_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cmik00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PMARG_ME00134 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PMARG_ME00134 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PMARG_ME00134 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cmik01004]
    PMARG_ME00134 (fabI)
Enzymes [BR:cmik01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PMARG_ME00134 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PMARG_ME00134 (fabI)
Lipid biosynthesis proteins [BR:cmik01004]
 Fatty acid synthase
  Component type
   PMARG_ME00134 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: CUX95783
UniProt: A0A143WQ14
LinkDB All DBs
Position
I:127690..128475
Genome map
AA seq 261 aa AA seqDB search
MNFLTGKRILVTGIANNHSIAYGIAQALHRAGAELAFSYQNKKNKLRLEKFAKNFNSNIV
LPCDVTKDTSIKELFNSLAKIWIKFDGFIHSIAYAPKKQFKGDFINVINRKSFTIAHDIS
SYSFVAMAKASRYMLNPKASLVTLTYIGAERAIFNYNVMGLAKASLEANTRYMANAMGPQ
KIRVNAISAGPIKTLAALGIKNFKKIISYYKSVIPMRRLITIDDIGNTAAFLCSDLSSGI
TGEIIHVDGGFNIVAMNELNL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaattttcttactggtaagcgtattcttgttactggaattgctaataatcattcaatt
gcatatggtattgctcaagctttgcatcgtgccggtgcagaactggcattttcttatcaa
aataaaaaaaataaattaagattagaaaagtttgctaagaattttaattctaacatagta
ttaccatgtgatgttacaaaagatactagtattaaagaattatttaatagtttagctaaa
atttggattaaatttgatggatttatacattctattgcttatgctcctaaaaaacaattc
aaaggtgattttatcaatgttattaatcgtaaaagttttactattgcacatgatatcagt
tcttatagttttgtagctatggctaaagctagtagatatatgttgaatcctaaagcttct
ttagtaacattaacttatataggagctgaacgtgctatatttaactataatgttatgggt
ttagctaaagcttctttagaagctaatacacgctatatggctaatgctatgggtccccag
aaaattagagttaatgctatttctgcaggtcctattaaaactttagctgctttaggtata
aaaaattttaaaaaaataatatcttactataaatcagtaatacctatgagacgtttaatt
actattgatgacattggtaatactgctgcttttttatgttctgatttatcatctggaata
actggagaaataatacatgtagatggaggttttaatatagttgcaatgaatgaattaaat
ttgtaa

DBGET integrated database retrieval system