KEGG   Corynebacterium minutissimum: NCTC10288_00180Help
Entry
NCTC10288_00180   CDS       T05574                                 

Gene name
glpD
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cmin  Corynebacterium minutissimum
Pathway
cmin00564  Glycerophospholipid metabolism
cmin01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmin00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCTC10288_00180 (glpD)
Enzymes [BR:cmin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NCTC10288_00180 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_3 FAD_binding_2 Pyr_redox_2 Thi4 GIDA NAD_binding_8 Pyr_redox_3 HI0933_like 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: SQH98343
UniProt: A0A2X4R8W3
LinkDB All DBs
Position
1:186047..187771
Genome map
AA seq 574 aa AA seqDB search
MTTTSNHSFNPEYFEQTWNDYSTEDYDVVIIGGGSVGAGAAVDAATRGLKTAVLESQDFA
AGTSSRSSKMFHGGLRYLAMFDFRLVAESLKERELNMSTLAPHLVKPLKFIFPLTHRGWE
RVMMFGGFTLYDLMGGAKSVPMQKHLTRKGVLKVTPGLKEDAVVGGVRYYDTLVDDARHT
MTVLRTAAEYGASVRTGTEVIGFEKDNRGRITAAQVRDLETGRETTVKGKVFINATGVWN
DKIQEMAGAEGKFTVHASKGVHIVVPKDALDADAALCFVTEKSVLFVIPWGEYWIIGTTD
TDWEKGLSLPDPAPTKADIDYILDQVNQRVRNKITREDIVGVYSGLRPLLSGKSDSTTNL
SRNHAVARVAPGLVSVAGGKYTTYRVIGKDAVDLAAKELGFKVAESVTERTPILGADGYH
ALANQVPALARRYNLSEERIEHLLGRYGSLISEVLAPAAEDASLLEPVPGAESYIWAEVR
YAVTHEGALHIDDIVSRRLRVAIEFADRGVAAAQPIAEFVAPLLGWDQSDIEREVSHFKQ
HTEAELAAEAALTDREANDILERAGSARATKEEA
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacgagtaaccacagctttaaccccgagtattttgaacagacctggaacgac
tactccactgaagactatgacgtcgtcattatcggcggcggctcagtaggtgctggtgct
gcggtggatgcagccacccgcggtttgaagacggccgtgctggaatcccaagactttgcg
gcaggaacgtcctcgcgttcttccaagatgttccacggtggactgcgctacctcgccatg
tttgacttccgcctcgttgcggaatccctcaaggagcgcgagctcaacatgtcgaccttg
gccccgcacctggtcaagccgctgaagttcatcttccccctgacccaccgcggttgggag
cgcgtcatgatgttcggcggctttaccctctacgatctcatgggtggtgccaagagcgtc
ccgatgcagaagcacctcacccgcaagggcgtgctcaaggtgaccccgggcctcaaggag
gatgccgtcgtcggtggcgtgcgctactacgacacgcttgtcgacgacgcccgccacacc
atgaccgtcctgcgcaccgctgctgaatacggcgcaagcgtgcgtaccggtaccgaggtt
atcggtttcgagaaggacaaccgcggccgcatcaccgccgcgcaggtccgtgacctcgag
accggccgcgagactaccgttaagggcaaggtcttcatcaacgccacgggtgtctggaac
gacaagattcaggagatggccggcgcggagggcaagttcaccgttcacgcctccaagggt
gtgcacatcgttgtcccgaaggacgccctcgacgctgacgccgctctgtgcttcgtcacc
gaaaagtccgtgctcttcgtcattccttggggcgagtactggatcatcggtaccaccgat
actgactgggaaaagggcctgtccctgccggacccggccccaaccaaggcagatatcgac
tacatcctggaccaggtcaaccagcgcgtgcgcaacaagattacccgtgaggacatcgtt
ggtgtctactccggtctgcgcccgctgctgtccggtaagtccgactccaccaccaacctc
tcccgcaaccacgccgttgcccgcgtagccccgggccttgtctccgttgctggtggtaag
tacacgacctaccgcgttatcggtaaggacgcagtggacctggccgctaaggaactgggc
ttcaaggtggcagaatccgtcaccgagcgcaccccgatcttgggcgcggacggctaccac
gccttggccaaccaggttccggcgctcgcgcgccgctacaacctcagcgaggagcgcatc
gagcatctgctcggccgctacggttccctcatcagcgaggttctggctcctgccgccgag
gacgcctccctccttgagccggttccgggcgctgagagctacatctgggctgaggttcgc
tacgccgtcacccacgaaggtgcactgcacatcgacgacatcgtgtctcgccgcctgcgc
gtggccatcgagttcgccgaccgaggcgttgccgctgctcagcctattgctgagttcgtc
gcgccgctgctgggctgggaccagagcgacatcgagcgcgaggtttcccacttcaagcag
cacaccgaggcggagcttgccgccgaggctgccctcaccgaccgtgaggcaaatgacatt
ctcgagcgcgccggcagcgcacgagccactaaggaagaagcctaa

DBGET integrated database retrieval system