KEGG   Christensenella minuta: B1H56_00695Help
Entry
B1H56_00695       CDS       T05665                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
cmiu  Christensenella minuta
Pathway
cmiu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cmiu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    B1H56_00695
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cmiu03400]
    B1H56_00695
Enzymes [BR:cmiu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     B1H56_00695
DNA repair and recombination proteins [BR:cmiu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     B1H56_00695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AYH39133
UniProt: A0A136Q1B7
LinkDB All DBs
Position
143022..143600
Genome map
AA seq 192 aa AA seqDB search
MDSNSLERLYDRISGAYPGQELVFGDGKPDAGLMLVGEAPGRDEVAQKKPFVGRAGQNLT
GFLKTLGLSRTEIYVTNVCKFRPTKVSAKNTVSNRPPTREEILAAQPFLWEEIRLVAPRL
LVTLGNTPLRAVRGFNAVIGDHHGKAERISLGTGEYWLFALYHPASIIYNPSLKETYSQD
LSNLAVWLGKNI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggactcgaactctcttgaacgtttatatgatcggatcagcggagcatatccggggcag
gagcttgtgtttggcgacgggaagccggatgcggggctgatgctcgtgggagaagcgccg
ggccgggacgaggtcgcgcagaaaaaaccgtttgtgggccgggccgggcaaaacctgacc
gggttccttaaaacacttgggctgtcccggacggagatttacgttacaaacgtatgtaaa
ttccggcctacgaaggtgagcgccaaaaacacggtttccaaccgtccgcccacccgggag
gaaatccttgccgcacaaccgttcctgtgggaagagatcaggctcgttgcgccccggctt
cttgtgacgcttggaaacacgccgcttcgcgcggtcagggggtttaacgccgtcatcggc
gatcaccacggcaaagcggagcgaatttccctcggcacaggggaatattggctgtttgcg
ctctatcatccggccagcatcatctacaatccctccctcaaagaaacctattcccaggat
ctttcaaatttggccgtatggctgggaaaaaatatctga

DBGET integrated database retrieval system