KEGG   Christensenella minuta: B1H56_02645Help
Entry
B1H56_02645       CDS       T05665                                 

Definition
(GenBank) sugar phosphate isomerase/epimerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
cmiu  Christensenella minuta
Pathway
cmiu00040  Pentose and glucuronate interconversions
cmiu00051  Fructose and mannose metabolism
cmiu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmiu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B1H56_02645
   00051 Fructose and mannose metabolism
    B1H56_02645
Enzymes [BR:cmiu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     B1H56_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 DUF4862
Motif
Other DBs
NCBI-ProteinID: AYH39477
LinkDB All DBs
Position
548790..549788
Genome map
AA seq 332 aa AA seqDB search
MEGVTMFQPKYSIILANVGMCADRYMSGGYSDPCTIDEMFRRVASVDGVSGVELVSDWNI
TAKNVDQVRRNLEEYGLKLVSIIPDHFGEMKWGKGAFTSKDPAIRKQAVEDTKELMDISA
ELGGNLISLWPGQDGYDYYFQGDYIREHEWFAEGVQECCDYRKDVNISIEYKIKEPRNFS
YPSTMAVILLMLEKLGRENSGVTIDYGHAHVAGENVAESVALAKEYGNRLLHVHMNDNYG
FWDDDMIAGSIHTIPFIEFFYWLKRTGYDGYISTDQYPYREDGRDAVNETVRWMDIFAGL
ANRIDEKELEEIYATGNACEVSAMLRDLMFGK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgtaacgatgtttcaaccaaaatacagtattatccttgcaaatgtgggcatg
tgtgcagaccgctatatgagcggcgggtattctgatccctgcacgattgacgaaatgttc
cggcgcgtcgcttccgtggacggcgtcagcggggtggagcttgtaagcgattggaatatt
acggctaaaaatgtggatcaggttcggagaaaccttgaagaatacgggcttaaacttgta
tcgattattcccgaccatttcggggaaatgaaatggggcaagggggcgtttacctccaag
gatcctgcaattcgtaaacaggcggtggaagataccaaagaattaatggatatttccgca
gaactgggcgggaatctgattagtctgtggccggggcaggacggctatgattattatttc
cagggcgactatatccgcgagcatgaatggtttgcggaaggcgtgcaggaatgctgcgat
tatcgtaaggacgtcaatatttcgatagaatataagattaaagagccgcgcaatttctcc
tatccttcgacgatggcggtgattctgctgatgcttgaaaagctgggcagggaaaacagc
ggtgtaacgatcgattacggacatgcgcacgtagcgggcgaaaacgtggcggaatccgtt
gcgcttgccaaagaatacggcaacaggctgctgcacgtccacatgaatgacaattacggt
ttctgggacgacgatatgatcgcgggatcaattcatacgattccttttatcgagttcttt
tattggctgaagagaaccggatatgacggatacatttcaaccgaccagtatccttaccgc
gaagacggcagggatgcggtcaatgaaacggtgcggtggatggatatttttgccggactt
gcaaaccgcatcgatgaaaaagaactggaagagatctatgcgacaggaaatgcgtgtgaa
gtgagcgcaatgctgagagatttaatgtttgggaaataa

DBGET integrated database retrieval system