KEGG   Christensenella minuta: B1H56_04205Help
Entry
B1H56_04205       CDS       T05665                                 

Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cmiu  Christensenella minuta
Brite
KEGG Orthology (KO) [BR:cmiu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmiu01001]
    B1H56_04205
Enzymes [BR:cmiu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     B1H56_04205
Protein kinases [BR:cmiu01001]
 Serine/threonine kinases: Other
  Bacterial family
   B1H56_04205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RskA
Motif
Other DBs
NCBI-ProteinID: AYH39749
UniProt: A0A136Q2T5
LinkDB All DBs
Position
complement(869684..871567)
Genome map
AA seq 627 aa AA seqDB search
MIGPDTVLAGRYRLIEQIDSGGSAYIYKAMDELTKQIVAVKILKPELTENEEFVQRFKKE
VQAAAKLRHANIIRAYDAGLDNGTYYIVMDLIEGKTLKHLINVNGPLPVKYAVAVAKKLC
LALEYAHVKGFVHRDIKPHNVMIDMTGEPYIADFGIARNIAQNTITAEEGSVMGSVHYFS
PEQARGERVDKRSDIYSLGILLYEMVTGKVPFDADTSVAIALKHINDPMPDAKESAPSLP
ESINKIIQKATQKDKHFRYKSAFNMYEDLQRCLSEPDGEYVKYSESKRTQQHIEEAHAKR
SKKSVKRLVLVFGVAAVVVFAIIAVVSAVINFNVERPVPLPDFVGMTEKNAVEAAQKVTS
MPTVTYENSSEAEKGVVIRQDPEAGMDFKKDDPLTLVVSNGSGSDIMPDVTNMDRAQAEK
ILRENGIEWDQIVEDTTGDAPIGYVIEQHPAAGESVSRSGSVWLTVKASPDIQKISMPNI
QSMTLPDALNVLKLRDLSLFFIYEKDSDEEENTVISQKPAENTEISTNSSVELTVPASSG
RRYKVSKPINLTIPKDGTSLRIGIPGNVDGVSVYYIIYGAVVEAGDQAIEPTGTIVIDSD
EDVAQKDLAIFLNDVQVKTETVEFVRG
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggccggacacggtgcttgccggacgctaccggttgattgagcaaatagattcg
ggcggatccgcctatatttataaagcaatggacgagcttaccaaacaaatcgttgccgtc
aaaattctgaagcccgaacttacggagaacgaggaattcgtacagcgcttcaaaaaggaa
gttcaggcggcggcgaagctccgccatgccaatattatccgcgcttatgatgccggtctt
gataatgggacttattatattgtcatggatcttatcgaagggaaaacgcttaagcacttg
attaatgtcaatgggcctctgcctgtcaagtatgcggtggcggtggcaaagaagctttgt
cttgcgcttgaatatgcacatgtaaaaggattcgtacaccgggatatcaagccgcataat
gtaatgatcgatatgacgggagagccgtatattgcggatttcggaattgcccgcaacatt
gcccaaaatacgattaccgcggaagaaggaagcgtgatgggctccgtgcactatttctct
ccggagcaggcgcgcggtgaacgggtggataaacgttccgatatttattcacttgggata
ttactttatgaaatggtgacgggtaaagtgccctttgatgcggatacatccgttgcgatc
gctttgaagcatatcaacgaccctatgccggatgccaaggaatcagcgccctccctcccg
gagagcatcaataagatcatccagaaggcaacgcagaaggataagcattttcgttacaaa
tccgcatttaatatgtatgaggatttacagcggtgcctttctgagcctgatggcgaatac
gtaaaatacagtgagagcaaacgaacccagcagcatatcgaagaagcccatgcgaagcgg
tcgaaaaaaagcgtaaaacggctggttttggtttttggggtagccgccgtcgttgttttt
gcgatcattgcggttgtaagcgcagtgataaatttcaatgtggaacggcccgtgccatta
cccgactttgtgggtatgacagagaaaaatgccgtagaagcagcacaaaaagttacctcg
atgcccaccgtgacctatgaaaattcttctgaagcggaaaagggcgttgtgatacgccag
gaccccgaagccggaatggattttaaaaaagacgatccgctgacgctcgtggtgagtaac
ggaagcggctccgatattatgcccgatgttaccaatatggaccgggcacaggcagagaag
attttgcgggagaacggtattgaatgggatcagatcgtagaggatactacgggcgacgcg
cccattggatatgtcatcgagcagcatcctgcggcgggggaatccgtttccaggagcgga
agcgtatggcttaccgtcaaggcttcgccggatattcaaaaaatttcaatgccaaatatc
cagagcatgacgcttcccgatgcgttaaacgtactgaagctcagagacctgagcctgttc
tttatttatgagaaagacagtgatgaagaagaaaatacggtgatttcgcagaaaccagcc
gaaaatacggagatatccaccaatagctcagtggagctgactgttccggcatcgagcgga
aggagatataaggtttccaagccgattaacctcacaattcccaaggatggaacctccctg
cgtatcgggatacccggaaatgtagacggagtttccgtctactatattatctatggagcg
gttgttgaagcgggcgaccaggcgatcgaaccaactggaaccatcgtaatcgattccgat
gaggatgtcgcgcaaaaagatctggcaatcttcctcaatgatgttcaggtgaaaacggaa
acagtggaatttgtaagggggtaa

DBGET integrated database retrieval system