KEGG   Christensenella minuta: B1H56_08580Help
Entry
B1H56_08580       CDS       T05665                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cmiu  Christensenella minuta
Pathway
cmiu00040  Pentose and glucuronate interconversions
cmiu00051  Fructose and mannose metabolism
cmiu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmiu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B1H56_08580
   00051 Fructose and mannose metabolism
    B1H56_08580
Enzymes [BR:cmiu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     B1H56_08580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N UDPG_MGDP_dh_N Pyr_redox_2 NAD_binding_3 Pyr_redox ADH_N_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AYH40535
LinkDB All DBs
Position
complement(1812652..1813701)
Genome map
AA seq 349 aa AA seqDB search
MKGTMKVAVMNGVGKMGYTERPIPQPKDDEVLVKLEYVGICGSDLHFYEAGAIGGHVVEP
PFVLGHEPGGTVVEVGKDVKHLKVGDRVALEPGKTCGHCEFCKSGRYNLCPDVIFFATPP
VDGVFQEYVAHEADLCFKLPDNVSTLEGALIEPLAVGFHAANQGGAELGQTAVVMGAGCI
GLVSMMALRAKGVSKVYVVDIMPKRLEKAVELGATGVVNGARQDVVKEIMDLTEGRGCDL
VIETAGSEITMQQAIKGAKKGGTVVFVGYSLKDNADIPMNLALDKELTFKTIFRYRNIYP
MAIEAVASGKVDLRNIVTDIFPFSDIQNAMDQSVENKANIVKAVVKIAD
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttgaagggaacaatgaaagtcgccgttatgaacggcgtaggaaaaatgggttatacggag
cggccgatcccgcagccgaaggacgatgaagtattggtgaagctggaatatgtgggaatc
tgcggttcagacctccatttttatgaagcgggcgccatcggcggccatgtggtggagccg
ccttttgtcctggggcacgagcccggcggcacggtggtggaagtcggcaaggatgtaaag
cacctcaaagtgggagaccgcgtcgcgctggaaccgggcaagacgtgcgggcactgcgaa
ttctgtaaaagcgggcgctataacctctgcccggacgtgatcttctttgcgacgccgcct
gtggacggcgtgttccaggaatatgtggcgcacgaggcagacctatgcttcaagcttccg
gataatgtgagcaccctcgagggcgcgctgatcgagccgctggcagtcggcttccatgcc
gcaaaccagggcggcgccgagcttggtcagacggctgttgtaatgggcgcgggctgcatc
ggcctggtgtccatgatggcgctgagggccaagggcgtttcaaaggtctatgtagtggat
atcatgccgaagcggctggagaaagcggtcgaactcggcgcaacgggcgtggtcaacggc
gcgcggcaggacgtagtaaaagaaattatggacctgacggagggaagaggatgcgacctc
gtcattgagaccgccggcagcgagatcaccatgcagcaggcaattaaaggggcgaaaaaa
ggaggcacagtcgtttttgtgggttattccctgaaagataatgcggacatccccatgaac
cttgctctcgataaggaactgaccttcaagacgatcttccgctaccgcaacatctatccg
atggcgatcgaagcggttgcgtcgggcaaggtcgacctgaggaacatcgtgacggatatt
ttcccgttcagcgatatccagaacgcgatggaccaaagcgtggaaaacaaggcaaatatc
gtcaaggcggtcgtgaaaatcgcggactaa

DBGET integrated database retrieval system