KEGG   Cronobacter malonaticus LMG 23826: AFK66_007015Help
Entry
AFK66_007015      CDS       T04062                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cmj  Cronobacter malonaticus LMG 23826
Pathway
cmj00250  Alanine, aspartate and glutamate metabolism
cmj00280  Valine, leucine and isoleucine degradation
cmj00410  beta-Alanine metabolism
cmj00640  Propanoate metabolism
cmj00650  Butanoate metabolism
cmj01100  Metabolic pathways
cmj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AFK66_007015
   00650 Butanoate metabolism
    AFK66_007015
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFK66_007015
   00280 Valine, leucine and isoleucine degradation
    AFK66_007015
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AFK66_007015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmj01007]
    AFK66_007015
Enzymes [BR:cmj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AFK66_007015
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AFK66_007015
Amino acid related enzymes [BR:cmj01007]
 Aminotransferase (transaminase)
  Class III
   AFK66_007015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALX78063
LinkDB All DBs
Position
1414341..1415636
Genome map
AA seq 431 aa AA seqDB search
MQSNQQWQERREQAVPQGVGNALPVFVARAKNAEIWDVEGRRYIDFASGIAVLNTGHNHP
AVIAAVKAQLDNFTHPCFQVTPYGNYIELAERLNRLAPISEPCQTLFLSTGAEAVENAIK
VARIATGRSAVIAFRGAFHGRTLLGMALTGKVQPYKKGYGPFPAGIYHAPYPAAYLGVSD
TQALASLAGIFAADVAPEEVAAIIIEPVQGEGGFYAASAEFMQQLRALCDKHGIVLIVDE
IQSGFCRTGKTFAIEHSGVEPDLITMAKSLAGGFPLSGLVGKKALFDKALPGGLGGTYAG
SPVSIAAALAVTDLIEEEQLNARAIAQGELLMSRLRELAQEYDFIGDVRGVGAMVAMELV
HERDSHRPDKELTQQLVQEAGRQGLILLTCGVRANVIRFLIPLTAEKEIVTEGLNILSSC
LKVVQNTRPAK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcaatcagcagtggcaggagagacgcgagcaggcggtgccgcagggcgtgggt
aacgcgctgccggtatttgtggcgcgggctaagaacgcggaaatctgggatgtggagggg
cggcgctatatcgatttcgcctccggcattgcggtgctcaataccgggcacaatcacccg
gcggttatcgcggcggtgaaggcgcagctcgataattttacgcatccctgttttcaggtc
acgccttacggcaattacattgagctcgcggaacgcctgaaccggctggctcccatcagc
gaaccctgccagacgctgtttctctcaaccggcgccgaggccgtggaaaacgccattaaa
gtggcgcgtatcgccacggggcgctcggcggtgattgcgtttcgcggcgcgtttcatggc
cgtacgctgcttggcatggcgctcaccggcaaagtgcagccgtataaaaaaggctatggc
ccgttcccggcggggatttaccacgcgccttacccggcggcgtatctgggcgtgagcgac
acgcaggcgctggcgtcgctggcggggattttcgccgcagatgtggcacccgaagaggtg
gcggcgatcattatcgagccggtgcagggcgagggcgggttttacgccgcctctgccgag
tttatgcagcagttgcgtgcactgtgcgataaacatggcatcgtgctgattgtcgatgag
atccagagcggcttctgccgtaccggaaaaaccttcgccatcgaacattcaggtgttgag
ccggatctcattaccatggccaaaagcctggcgggcgggttcccactctcggggctggtg
ggtaaaaaggcgctgtttgataaagccctgccgggcgggcttggcggcacgtatgccggg
tcgccggtgagtatcgccgcggcgctggcggtgaccgatctcatcgaagaggagcaatta
aacgcacgcgccatcgcgcagggcgagctgctgatgagccgcctgcgcgaactggcgcag
gagtatgactttatcggcgatgtgcgcggcgtcggcgcgatggtggcgatggagctggtg
catgagcgcgacagccatcgcccggacaaagaattgacccagcaactggtgcaggaggca
gggcgtcaggggctgattttactgacctgcggcgtgcgtgcgaacgtcatccgtttcctt
atcccgctcaccgctgagaaagaaattgtgacagaaggtctcaacatcttgtcatcctgc
cttaaagtggtgcaaaatacgcgccctgcaaaataa

DBGET integrated database retrieval system