KEGG   Cronobacter malonaticus LMG 23826: AFK66_009555Help
Entry
AFK66_009555      CDS       T04062                                 

Definition
(GenBank) transporter
Organism
cmj  Cronobacter malonaticus LMG 23826
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2
Motif
Other DBs
NCBI-ProteinID: ALX78639
LinkDB All DBs
Position
complement(2001886..2003079)
Genome map
AA seq 397 aa AA seqDB search
MLSKKTRSTVALLGSSLMLTIGRGATLPFMAIYLAKRFAMSVDEIGVALTSAMTAGVFFS
LAFSVFADRFDKKRYMLIAIAIFVAGFVAIPLMHNALLVILFFAIINCAYSVFSTVLKSY
FADTLGAAAKARIFSLNYTFLNIGWTVGPPIGTLLMVYGLNMPFWLSAVTSGMTFMVISV
FVERLAPAHEQADTPAGPPPLSLLWRDQRLLWFTGSAFLGSLVAGSFAVCISQYVLTFSD
SALAQQVVAVVLPVNAVLVVSLQYLVGRKLRAENLSRLMLFGTVCFILGLGGFLISGTNL
WMWGAAAAVFTLGEIIYAPGEYMLIDNIAPPGLKAGYFSVQSLGWLGAAFNPMYSGFVLT
TLPSWSLFASLMVFAAMAYLMMVKGMRVKVVGVMQPG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttatcaaagaaaacgcgttccaccgtcgcgctgttaggttcatcgttaatgctgacc
atcggccgcggcgccacgctgccgtttatggcgatttatctcgcgaagcgcttcgcgatg
tcggttgatgaaatcggcgtcgcgctaaccagcgcgatgaccgcaggcgtttttttcagc
ctggcgttcagcgtattcgccgaccgcttcgataaaaagcgctatatgctcatcgctatc
gccatctttgtggcgggctttgtggcgatcccgctgatgcataacgccctgctggtgatc
ctctttttcgccatcattaactgcgcgtactccgtgttttctactgtcctgaaaagttat
ttcgccgacacgctgggcgcggcggccaaagcgcgtattttctcgctcaactatacgttc
ctgaatatcggctggactgtcggcccgcccatcggcacgctgctgatggtctatggcctc
aatatgccgttctggctctcggcggtgacgtccggcatgacctttatggtgattagcgtt
tttgtcgagcgcctggcaccggcgcatgagcaggcggatacgcccgcaggcccgccgccg
ctctcactgctgtggcgcgaccagcgtctgctgtggtttaccggctcggcgtttctcggc
tcgctggtggccggctcctttgccgtctgtatttcgcaatacgtcttaaccttttccgac
agcgcgctggcgcaacaggttgtcgcggtggtgctgccggtcaacgccgttcttgtggtt
tcgctgcaatatctggtgggcagaaaactgcgcgccgagaacttaagccgcctgatgctc
ttcggcaccgtctgctttattctcggcctcggcggtttcctgatatcgggcaccaacctc
tggatgtggggcgcggccgccgcggtctttacgcttggtgaaatcatctacgcgccgggc
gaatatatgctgatcgacaatatcgccccgccgggcctgaaagccggttatttctcagtc
cagtcgctcggctggctgggcgcggcgtttaacccgatgtacagcggctttgtgctgacc
acgctgccgtcatggtcgctgttcgcgtcactgatggtcttcgccgctatggcgtatctg
atgatggtgaaaggcatgcgcgtgaaggtcgtcggtgtgatgcagccgggctga

DBGET integrated database retrieval system