KEGG   Cronobacter malonaticus LMG 23826: AFK66_010465Help
Entry
AFK66_010465      CDS       T04062                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cmj  Cronobacter malonaticus LMG 23826
Pathway
cmj00480  Glutathione metabolism
cmj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFK66_010465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmj02000]
    AFK66_010465
Enzymes [BR:cmj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AFK66_010465
Transporters [BR:cmj02000]
 Other transporters
  Pores ion channels [TC:1]
   AFK66_010465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_C_2 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ALX78809
LinkDB All DBs
Position
2196403..2197011
Genome map
AA seq 202 aa AA seqDB search
MKLFYKAGACSLSPHIILREANIDFTLVAVDLAAKRTETGEDYLTINPKGQVPALLLDDN
TLLTEGVAIVQYIADLVPDRQLLAPVGSMTRYHTLEWLNYIATELHKGFTPLFRPDTPDE
YKTIARAQLQKKFAYVNEALAQKQWLMGLRFSVADAYLFTVLNWAKAVGLEMQAFDNIAD
YQARVKARPAVEAALKAEGLSA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttttacaaagccggcgcgtgttcgctttcgccgcacattattctgcgcgaa
gccaatatcgatttcacgctggtggcggtggatctggccgctaaacgtacggaaaccggc
gaagactatctgaccattaacccgaaaggccaggtgccggcgctgctgctggatgacaat
acgctgctcacggaaggcgtggctatcgtgcagtacatcgcagatcttgtcccggaccgc
cagttgctcgcgccggttggcagcatgacccgttatcatacgctggagtggctgaactat
atcgccaccgagctgcataaaggcttcacgccgctgttccgcccggatacaccggacgag
tacaagaccattgctcgcgcgcagctgcagaagaaattcgcgtacgtgaatgaggcattg
gcgcagaaacagtggctgatggggctacgtttcagcgtggcggatgcgtatctgtttacc
gtgctgaactgggcgaaagcggtcgggcttgagatgcaggcgtttgacaatattgctgac
taccaggcgcgcgtcaaagcgcgtcctgccgtcgaggcggcgctcaaagcggaaggcctg
agcgcgtaa

DBGET integrated database retrieval system