KEGG   Cronobacter malonaticus LMG 23826: AFK66_011935Help
Entry
AFK66_011935      CDS       T04062                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cmj  Cronobacter malonaticus LMG 23826
Pathway
cmj00520  Amino sugar and nucleotide sugar metabolism
cmj01100  Metabolic pathways
cmj01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFK66_011935
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AFK66_011935
Enzymes [BR:cmj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AFK66_011935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ALX79024
LinkDB All DBs
Position
complement(2437127..2438152)
Genome map
AA seq 341 aa AA seqDB search
MGPVMLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVRQIRASARNHLVIA
VDQEGGRVQRFREGFTRLPAAQSFAALLGMDAGGKLAEEAGWLMACEMIAMDIDISFAPV
LDVGHLSAAIGERSFHDKPENVLAMAKRFITGMQSAGMKATGKHFPGHGAVSADSHKETP
RDPRPAAEIRRHDMLPFRELFSYNMLDAVMPAHVVYSDVDPLPASGSPYWLKQVLRKELG
FDGVIFSDDLSMEGAAILGSYAERGQAALDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TRLYHKGVITRQELMASARWKQVSGELTALHERWQTHKAGQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggtccggtcatgctggatgtggaaggttatgagcttgatgccgaagagcgtgaaatc
ctcgcgcatccgctggtgggagggcttatcctctttacccgcaactatcacgatccagag
cagttgcgcgagctggtccgccagatccgcgcgagcgcccgcaatcatttggtgattgcc
gtagaccaggagggcgggcgcgtacagcgtttccgcgagggctttacccgcctgccggcg
gcgcaaagcttcgccgcgctgctcggcatggacgcgggcggcaaactggcggaagaagcc
ggctggctgatggcctgcgaaatgatcgcgatggatatcgatatcagttttgcgccggtg
ctggatgtcgggcatctcagcgccgcgattggcgagcgttccttccacgataagcctgaa
aacgtgctggcgatggcaaagcgtttcatcaccggcatgcagagcgcgggaatgaaagcg
acgggcaaacatttccccggccacggcgccgtgagcgctgattcccataaagagacgccg
cgcgacccgcgtccggccgcggaaattcgccgccacgacatgctgccgtttcgcgaactc
tttagttacaacatgcttgatgcggtgatgccggcgcacgtcgtctatagcgacgtcgat
ccgctgccggcgagtggttcgccttactggctgaagcaggtgctgcgtaaggagctgggg
tttgatggcgtgatattttccgacgatctgtcgatggaaggtgcggctatcctcggaagc
tatgcggagcgcggccaggcggcgctggatgccggttgcgatatgatccttgtctgtaat
aatcgtaagggtgccgtaagcgttcttgataacctgtcaccgatcaaagcagagcgtgtt
acacgtttgtatcataaaggtgtaattacgcgtcaggaactgatggcgtcggcgcgctgg
aagcaggtgagcggggagcttaccgcgctgcatgagcgctggcagacgcacaaggcgggg
caataa

DBGET integrated database retrieval system