KEGG   Cronobacter malonaticus LMG 23826: AFK66_013580Help
Entry
AFK66_013580      CDS       T04062                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cmj  Cronobacter malonaticus LMG 23826
Pathway
cmj00020  Citrate cycle (TCA cycle)
cmj00190  Oxidative phosphorylation
cmj00650  Butanoate metabolism
cmj01100  Metabolic pathways
cmj01110  Biosynthesis of secondary metabolites
cmj01120  Microbial metabolism in diverse environments
cmj01130  Biosynthesis of antibiotics
cmj01200  Carbon metabolism
Module
cmj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cmj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFK66_013580 (sdhA)
   00650 Butanoate metabolism
    AFK66_013580 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AFK66_013580 (sdhA)
Enzymes [BR:cmj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AFK66_013580 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AFK66_013580 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: ALX79350
LinkDB All DBs
Position
complement(2801036..2802802)
Genome map
AA seq 588 aa AA seqDB search
MNLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGQLRDASDSDVEFSLERLNRWNNNRSGEDPVEIRKALQECMQHNFSVFREGDAM
AKGLEQLKAIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDYPDRDDENWLCHSLYLPQTESMTRREVNMQPKLRPAFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgccagtcagagaatttgatgccgttgttattggcgcaggcggcgcaggtatg
cgcgcggcgctgcagatttcccagagcggccagacctgtgcgctgctttccaaggtgttc
ccgacccgttctcacaccgtctccgcccagggcggcattaccgttgcgcttggcaattcc
catgaagataactgggaatggcacatgtatgacacggtaaaaggttccgactatatcggc
gaccaggacgcgattgaatatatgtgtaaaaccggcccggaagcgattctggagcttgag
cacatggggctgccgttctcccgtcttgatgacggccgtatttatcagcgcccgttcggc
ggccagtcgaaaaacttcggcggcgagcaggccgcgcgcaccgcggcggcggcggaccgt
accggtcacgcgctgctgcatacgctctatcagcagaacctgaaaaaccacaccaccatt
ttctctgagtggtatgcgctggatctggtgaaaaaccaggatggcgcggtggtgggttgc
accgcactgtgcatcgaaaccggcgaagtggtctactttaaagcccgcgcgaccgtgctg
gcgaccggcggcgcaggccgtatttatcagtctaccaccaacgcccacattaacaccggc
gacggtgtcggcatggcgctgcgcgctggcgtgccggtgcaggacatggaaatgtggcag
ttccatccgaccggcatcgccggcgcgggcgtactcgtcaccgaagggtgccgcggcgaa
ggcggctacctgctcaacaaacatggcgagcgctttatggagcgttacgcgccgaacgcg
aaagatctggcgggccgcgacgtcgttgcgcgctctatcatgattgaaatccgcgaaggc
cgcggctgcgacggtccgtggggcccgcacgccaagctgaagctcgaccatctcggtaaa
gaagtgctggaatcccgcctgccgggcatcctggaactctcccgtacctttgctcacgtt
gacccggtcaaagagccgatcccggttatcccgacctgccactatatgatgggcggtatt
ccgaccaaagtgaccggccaggcgctgaccgtgaacgagaagggcgaagacgtggtgatc
ccgggcctgttcgcggtcggcgaaatcgcctgcgtatccgtacacggtgcgaaccgtctg
ggcggcaactcgctgcttgaccttgtggtgttcggccgcgcggcgggcctgcatttgcag
gaatccatcgccgagcagggccagcttcgcgacgccagcgactccgacgtggagttctcg
ctggagcgcctcaaccgctggaacaacaaccgcagcggcgaagatccggtcgaaatccgc
aaagcgctgcaggaatgtatgcagcataacttctcggtattccgcgaaggcgacgcgatg
gccaaagggcttgagcagctgaaagctatccgcgagcgcctgaaaaacgcccgtctggac
gatacctccagcgagttcaacacccagcgcgttgagtgtctggagctggataacctgatg
gaaaccgcttacgccaccgccgtatcggcgaacttccgtaccgagagccgtggcgcgcac
agccgcttcgactacccggaccgcgacgacgaaaactggctgtgccacagcctctatttg
ccgcaaaccgagagcatgacgcgtcgcgaagtgaatatgcagcctaagctgcgcccggct
ttcccgccgaaagtgcgtacttattaa

DBGET integrated database retrieval system