KEGG   Cronobacter malonaticus LMG 23826: AFK66_014935Help
Entry
AFK66_014935      CDS       T04062                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
cmj  Cronobacter malonaticus LMG 23826
Pathway
cmj00330  Arginine and proline metabolism
cmj01100  Metabolic pathways
cmj01110  Biosynthesis of secondary metabolites
cmj01130  Biosynthesis of antibiotics
cmj01230  Biosynthesis of amino acids
Module
cmj_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cmj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AFK66_014935
Enzymes [BR:cmj01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     AFK66_014935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 GFO_IDH_MocA Shikimate_DH 3HCDH_N PDH Sacchrp_dh_NADP NAD_Gly3P_dh_N OCD_Mu_crystall 2-Hacid_dh_C Helicase_RecD ApbA
Motif
Other DBs
NCBI-ProteinID: ALX79608
LinkDB All DBs
Position
3093279..3094088
Genome map
AA seq 269 aa AA seqDB search
MEKKTGFIGCGNMGKAILSGLLTSGQTRAENVWVYTPSEESQQELKQEFGINAASSAQEV
AQAADIVFGAVKPNIMLKVMSDIASSLNKDSLVVSIAAGITLDQLATVLGHDRKIIRTMP
NTPSLVQAGMTSITPNALVSEEEIRDVLAMFRSFGEAEVVAEYLIHPVVGVSGSAPAYVF
MFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGKHPGELKDMVCSPGGTTIEAV
RVLEERGMRAAVIEAMAQCMAKSEKLSKG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaagaaaacaggctttatcggttgcggcaatatgggcaaggccattctcagcggc
ctgctcaccagcggccagacgcgggcggaaaacgtctgggtctatacgccatcggaagag
agccagcaggaactcaagcaggagtttggtatcaatgccgcctccagcgcgcaggaagtg
gcccaggccgcggatatcgtgtttggcgcggtgaagcccaacatcatgctgaaagtcatg
agcgatatcgcctccagcctgaataaagactcgctggtggtctccatcgccgccgggatc
acgctggatcagctggcgactgtccttgggcacgaccgaaaaattatccgcactatgccg
aacacgccgtcgctggtgcaggccgggatgacctccatcacgccgaacgcgctggtcagc
gaggaagaaatccgggatgtgctcgcgatgttccgaagctttggcgaggcggaagtggtg
gcggagtatctgattcacccggtggtgggcgtcagcggctcggcacctgcgtatgtcttt
atgtttatcgaagcgatggccgacgccgccgtacttggcggtatgccgcgcgcgcaggcg
tataaattcgccgcccaggcggtgatgggctcggccaaaatggtgctggaaaccggcaaa
catccaggcgagctgaaagatatggtctgctcgccgggcggcacgaccatcgaagcggtg
cgggtgctggaagagcgcggcatgcgcgcggcggtgattgaagcgatggcccagtgtatg
gccaaatcggaaaagctcagcaagggctaa

DBGET integrated database retrieval system