KEGG   Cronobacter malonaticus LMG 23826: AFK66_014990Help
Entry
AFK66_014990      CDS       T04062                                 

Definition
(GenBank) beta-lactam-binding protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
cmj  Cronobacter malonaticus LMG 23826
Brite
KEGG Orthology (KO) [BR:cmj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cmj01002]
    AFK66_014990
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cmj01011]
    AFK66_014990
Enzymes [BR:cmj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AFK66_014990
   3.4.21  Serine endopeptidases
    3.4.21.-  
     AFK66_014990
Peptidases [BR:cmj01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   AFK66_014990
Peptidoglycan biosynthesis and degradation proteins [BR:cmj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AFK66_014990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11 pPIWI_RE_X
Motif
Other DBs
NCBI-ProteinID: ALX79619
LinkDB All DBs
Position
3104200..3105357
Genome map
AA seq 385 aa AA seqDB search
MKRCLLSCALLISAAFSAAQAAQTSPDPVFASDIVDRYANHIFYGSGATGMAIVVIDGNQ
RVFRSFGETRPGNNVRPQLDSVIRIASLTKLMTSEMLVKMLDQGVVKLDDPLSRYAPPGA
RVPTYQGEPIRLVNLATHTSALPREQPGGAAKRPVFVWPTREQRWQWLSTATLKAAPGAT
ASYSNLAFDLLADALANAAGKPYTQLFEEQITRPLGMKDTTFTPSPDQCKRLMVAEKGAS
PCNNTLAAIGSGGVYSTPDDMMRWMQQFLASDFHRRSPQADRMQTLIYQRTQLTRVVGMD
VPGKADALGLGWVYMAPKDGRPGIIQKTGGGGGFITYMAMIPQSNIGAFVVVTRSPLTRF
TAMSDGVNDLVTELSGNKPRQTTAL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgttgtctgctctcctgcgccctgctgataagcgcagctttttctgcggcccag
gccgcgcaaacctcgcccgacccggtcttcgcgtccgatatcgtcgatcgttacgctaac
catattttctacggcagcggcgccaccggcatggcgattgtagtgattgacggcaaccag
cgcgtgttccgcagcttcggcgaaacgcgccccggcaataacgtgcgcccgcagctcgac
tcggttatccgcatcgcctcgctcaccaaactgatgaccagcgaaatgctggtaaaaatg
ctcgatcagggcgtggtgaagcttgacgatccgctgagtcgctacgcgccccccggcgcg
cgcgtgccgacgtatcagggcgaacctattcgactggtgaacctcgccacgcataccagc
gccctgccccgtgaacagcccggcggcgcggcgaagcgcccggtgtttgtctggccgacc
cgcgagcagcgctggcaatggctctccaccgcgacgttaaaagcagcgcctggcgccacg
gcgtcctattccaacctcgcgttcgatctgctggccgatgcgctggctaacgccgcgggc
aagccttatacccagctttttgaagagcagatcacccgcccgctcggcatgaaagacacc
acctttacgccgtcaccggatcagtgcaaacgcctgatggtggcggagaaaggtgccagc
ccgtgcaataacacgctggcggctatcggcagcggcggcgtttactccacgccggacgac
atgatgcgctggatgcagcagttcctggcctccgatttccatcgccgcagcccgcaggca
gaccgcatgcagacgctgatttaccagcgcacgcagttgacccgcgtcgtcgggatggac
gtgccgggtaaagcggacgcgctggggctgggttgggtgtacatggcgccgaaagacggg
cgtccaggcatcattcagaaaaccggcggtggcggcggctttatcacttatatggcgatg
atcccgcagagcaatattggcgctttcgtcgtggtaacccgctcgccgctgacgcgcttt
accgcgatgagcgacggcgtcaacgatctggtgacggaactgagcggcaacaaaccgcgc
cagacgaccgccctgtaa

DBGET integrated database retrieval system