KEGG   Cronobacter malonaticus LMG 23826: AFK66_018555Help
Entry
AFK66_018555      CDS       T04062                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
cmj  Cronobacter malonaticus LMG 23826
Pathway
cmj00071  Fatty acid degradation
cmj00280  Valine, leucine and isoleucine degradation
cmj00281  Geraniol degradation
cmj00310  Lysine degradation
cmj00362  Benzoate degradation
cmj00380  Tryptophan metabolism
cmj00410  beta-Alanine metabolism
cmj00640  Propanoate metabolism
cmj00650  Butanoate metabolism
cmj00903  Limonene and pinene degradation
cmj00930  Caprolactam degradation
cmj01100  Metabolic pathways
cmj01110  Biosynthesis of secondary metabolites
cmj01120  Microbial metabolism in diverse environments
cmj01130  Biosynthesis of antibiotics
cmj01200  Carbon metabolism
cmj01212  Fatty acid metabolism
Module
cmj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AFK66_018555 (fadB)
   00650 Butanoate metabolism
    AFK66_018555 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AFK66_018555 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AFK66_018555 (fadB)
   00310 Lysine degradation
    AFK66_018555 (fadB)
   00380 Tryptophan metabolism
    AFK66_018555 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AFK66_018555 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AFK66_018555 (fadB)
   00281 Geraniol degradation
    AFK66_018555 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AFK66_018555 (fadB)
   00930 Caprolactam degradation
    AFK66_018555 (fadB)
Enzymes [BR:cmj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AFK66_018555 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AFK66_018555 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AFK66_018555 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     AFK66_018555 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ALX80252
LinkDB All DBs
Position
3831174..3833363
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLNWLEDGIAELVFDAPGSVNKLDTATVASLGHALDVLEKQHDLKALLLRSE
KAAFIVGADITEFLSLFQVPAEQLSQWLHFANSVFNRLEDLPVPTLCAINGYALGGGCEC
VLATDFRLATPDARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDITADAALK
VGLVDAVVKPEKLIEGTLRMLRQAIDGELDWKARRQPKLEPLRLSKIEATMSFTIAKGMV
MQTAGKHYPAPMTAVKTIEAAAGLGRDEALALENKSFVPLARSSEARALVGIFLNDQYVK
GLAKKLTKETETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINEKSLTLGISEASKLL
NKQLERGKIDGLKLAGVIATIHPTLDYAGFERADVVVEAVVENPKVKKAVLAETEQKVRP
DTVIASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDATIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDAGRFGQKNGKGFYAYQEDSKGKP
RKVPDNAVDSLLAEVSQPKRAFSDEEIVARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTQGSAKYLDMAQHYQHLGPLYEAPAGLRDKASHNAPYYPQVEPA
QPVGELQTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtaccttaactggctggaagacggcattgccgaactg
gtgttcgatgcccccggctcggtgaataagcttgataccgcgaccgtagcaagccttggc
catgcgctcgacgtgctggaaaaacagcacgatctcaaagccctgctgctgcgttcggaa
aaagccgcgtttatcgtcggcgccgacattaccgaattcctctcgctgttccaggtgcct
gctgagcaattaagccagtggctgcactttgccaacagcgtgtttaaccgccttgaagat
ctgccggtgcctacactttgcgccatcaacggctacgcgttaggcggcggctgcgagtgc
gtgctggcgaccgatttccgtctcgccacgccggatgcccgtatcggcctgccggaaacg
aaacttggcatcatgccgggctttggcggctcggtacgcctgccgcgtctgttgggcgcc
gacagcgcgctggaaatcatcgcggccggtaaagacatcaccgccgacgcggcgctgaaa
gtgggcctggttgatgcggtcgtgaaaccggaaaaactgatcgagggcacgctgcgtatg
ctgcgccaggccatcgacggcgagctcgactggaaagcccgccgccagccaaaacttgaa
ccgctgcgcttaagtaaaatcgaagccactatgagctttaccatcgccaaaggcatggtg
atgcagaccgcgggcaaacactacccggcgccgatgacggcggtgaaaaccatcgaagcg
gccgcagggctgggccgtgatgaagcgctggcgctggagaacaaaagctttgtgccgctg
gcgcgctccagcgaagcgcgcgcgctggtcggcatcttcttaaacgaccagtacgtcaaa
ggcctcgcgaaaaaactgaccaaagagaccgagacgccgaaacaggccgcggtactgggc
gcaggcattatgggcggcggcatcgcctaccagtcagcctggaaaggcgtgccggtcatc
atgaaagatatcaacgagaaatcactgacgctcggcatcagcgaagccagcaagctgctg
aataaacagctggagcgcggcaaaatcgacgggctgaagcttgcaggcgttatcgccacc
atccatccgacgctggattacgccggctttgagcgcgctgacgtggtcgtcgaggcggtg
gtcgaaaacccgaaagtgaaaaaagcggtgctggcggaaaccgaacaaaaagttcgcccg
gataccgtgattgcctccaatacctcgacgatccctatcagcgagctggcaagcgtgctg
aaacgcccggaaaacttctgcggcatgcacttctttaacccggtgcaccgtatgccgctg
gttgaagtgatccgcggcgagaaaacctccgacgccacgatagccaaagtggtggcctgg
gccagcaaaatgggcaaaacgccgattgtggtgaatgactgccccggcttcttcgtcaac
cgcgtgctgttcccctatttcgccgggttcagccagctgctgcgcgacggcgctgatttc
cgccagatagacaaagtgatggagaaacagttcggctggccgatgggcccggcgtatctg
ctggatgtcgtcggcatcgataccgcgcaccatgcacaggccgtgatggcggcgggtttc
ccgcagcgcatgcaaaaagattaccgcgatgctatcgacgcgctgtttgacgccggtcgc
ttcgggcagaaaaacggtaaaggtttctatgcctatcaggaagacagcaaaggcaaaccg
cgcaaagtgccggataacgcggtggacagcctgcttgcggaggtgagccagccgaagcgc
gcgttcagcgatgaagagatcgtcgcgcgcatgatgatcccgatggtcaacgaagtggtg
cgctgcctggaagaaggcattatcgccagccccgccgaggcggatatggcgctggtttac
ggtctcggcttcccgccgttccacggcggcgcgttccgctggctggatacgcagggcagc
gcgaaatacctcgatatggcgcagcactatcagcatctcggcccgctttatgaagcgccg
gcggggcttcgcgacaaagcgagccacaacgcgccttattatccccaggttgaacccgcc
caaccggtgggcgaactgcaaacggcttaa

DBGET integrated database retrieval system