KEGG   Cronobacter malonaticus LMG 23826: AFK66_019030Help
Entry
AFK66_019030      CDS       T04062                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cmj  Cronobacter malonaticus LMG 23826
Pathway
cmj00620  Pyruvate metabolism
cmj00680  Methane metabolism
cmj01100  Metabolic pathways
cmj01120  Microbial metabolism in diverse environments
cmj01200  Carbon metabolism
Module
cmj_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cmj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFK66_019030
  Energy metabolism
   00680 Methane metabolism
    AFK66_019030
Enzymes [BR:cmj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AFK66_019030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALX80336
UniProt: A0A0U3YR09
LinkDB All DBs
Position
3938142..3940793
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKLLGDTIKDALGENILDRVETIRKLSKSSRAGNEADRQALLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEIIARTLRKLKDQPDINET
AIRQAVEALSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDHKDIADYERNQIMRRLRQ
LIAQSWHTDEIRKNRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEAHLDYKLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLISELSMVECSDALR
EYVGTEGAQEPYRYLLKGLRAQLLATQAWLEARLKGQKLPKPQGLLTQNEQLWEPLYACY
ESLVACGLGIIANGELLDTLRRVKAFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSDNTREVLDTCKVIAEAPKGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKAGWRHIMDEL
SDISCTMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEDGKQDELETMCRDWPFFSTRLGMLEMVFAKADLWLAE
YYDQRLVKKELWPLGRELRQLLEADIKVVLDIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRLAEEEGKPADPCVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgctttgcgaagcaatgtcagtatgctcggcaagttgctcggg
gataccatcaaggatgcgctgggagaaaacatccttgaccgcgtagaaacaatccgcaag
ttgtcgaagtcgtcccgtgctggcaatgaagcagaccgccaggcgttgttaaccacgttg
caaaacctttccaacgatgaactgctgccggtggcccgcgcgttcagtcagttcctgaac
ctggccaacaccgccgagcaataccacagcatttcgccgaaaggcgaagccgccagcaac
ccggaaattatcgcccgcaccctgcgtaagcttaaagatcagcccgacatcaacgaaacc
gccatccgtcaggctgtagaggcgctgtcgctggaactggtgctgaccgcgcacccgacc
gagatcacccgccgcacgcttattcacaaaatggtcgaagttaacaactgcttaaaacaa
ctcgaccacaaagatatcgccgattacgagcgcaaccagatcatgcgccgcctgcgccag
cttatcgcgcagtcctggcacaccgatgaaattcgcaaaaatcgcccaagcccggtggac
gaggccaaatggggttttgcggtggtggaaaacagcctctgggaaggtgtgccgaattat
ctgcgcgagctgaatgaacagctcgaagcgcatctcgattacaaactgccggtggatttc
gtgccggtgcgtttcacctcctggatgggcggcgaccgcgacggcaacccgaacgtcacc
gcggatatcacccgtcacgttctgctgctaagccgctggaaagcgaccgacctgttcctg
aaagatatccaggtgctgatttccgagctctcgatggtcgagtgcagcgacgcgctgcgc
gaatatgtcggcaccgagggcgcgcaggagccttaccgttacctgctgaaagggctgcgc
gcgcagctgctcgcgacccaggcctggcttgaagcgcgcctgaaaggccagaagctgccg
aagccgcagggcctgctgacccaaaacgaacagctctgggaaccgctctacgcctgttat
gaatcgctcgtcgcctgtggtctggggatcatcgccaacggcgaactgctcgacaccctg
cgccgcgttaaagccttcggcgtgccgctggtgcgtatcgatatccgtcaggaaagcacc
cgccacaccgaagcgctgggcgagctgacccgctatctcggcattggcgactatgaaagc
tggtcggaagccgacaaacaggcgttcctgattcgcgaactcaactccaaacgtccgctg
ctgccgcgccagtgggagccgagcgataacacccgcgaagtgctggatacctgcaaagtg
atcgccgaagcgccgaaaggctcgatcgccgcgtacgtaatttccatggcgaaaacgccg
tccgacgtgctggccgttcacctgctgctgaaagaagcgggtattggcttcgcgctgccg
gtcgccccgctgtttgaaacgctcgacgacctgaacaatgccaatgacgtgatgacccag
ctgctgaatatcgactggtatcgcggctttattcagggcaaacagatggtgatgattggc
tattccgactccgcgaaagacgcgggcgtgatggccgcctcctgggcgcagtaccaggcg
caggacgcgctgatcaaaacctgcgagaaagcgggtatcgcgctgacgctgttccacggg
cgcggcggctccattggccgcggcggcgcaccggcgcacgcggcactactttcccagccg
ccgggcagcctgaagggcggcctgcgcgtgaccgaacagggcgagatgatccgctttaaa
tatggcctgccggaagtcaccatcagcagcctgtcgctctacaccagcgccattctggaa
gctaacctgctgccgccgccggagccgaaagccggctggcgtcacatcatggatgaactg
tccgacatctcctgcaccatgtaccgcggctacgtgcgcgaaaacaaggatttcgtgcca
tatttccgctcggccacgccggagcaggagctcggcaaactgccgctcggttcacgcccg
gccaagcgtcgtccgaccggcggcgtcgaatcgctgcgcgccattccgtggattttcgcc
tggacgcaaaaccggctgatgcttcccgcctggctgggcgcgggcgccgcgctgcaaaaa
gtggtggaagatggcaaacaggacgaactggaaaccatgtgccgcgactggccgttcttc
tccacgcgcctcggcatgctggagatggtctttgccaaagcggatctgtggctggcggaa
tactacgatcagcgtctggtgaaaaaggaactctggccgcttggccgtgagctgcgccag
ttgctggaagcagatattaaagtggtgctggatatcgccaacgactcgcatctgatggcg
gacttaccgtggattgccgagtccatccagctacgcaatatctacaccgacccgctgaac
gtgctccaggcagagctgctgcaccgttcacgcctggccgaggaagaaggcaaacccgcc
gacccgtgcgttgagcaggcgctgatggtcaccatcgcaggcgtcgcggcaggaatgcgc
aacacgggctga

DBGET integrated database retrieval system