KEGG   Callorhinchus milii (elephant shark): 103172656
Entry
103172656         CDS       T03088                                 

Gene name
nat1
Definition
(RefSeq) N-acetyltransferase 1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00232  Caffeine metabolism
cmk00983  Drug metabolism - other enzymes
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    103172656 (nat1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    103172656 (nat1)
Enzymes [BR:cmk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     103172656 (nat1)
SSDB
Motif
Pfam: Acetyltransf_2 Peptidase_C71 Myb_DNA-bind_7
Other DBs
NCBI-GeneID: 103172656
NCBI-ProteinID: XP_007883583
UniProt: V9KYW8
LinkDB
Position
Un
AA seq 292 aa
MNLPEYFARIGYQGQDDKADVETLRRIHEQHTLAIPYENLSIHCGEDIGLDLQMIYDKIV
KKKRGGWCTENNGLFYWVLKEMGYDVVMLGSQVYNCEDNMYSAKVDHLVLLTTIDNKPYL
SDVGFGVLKQMRQPLELTSGKDQPQLPGVYRLTEENGVWELERYGRKLQAADESYANSSL
FSRSPHQKMYKFTLATCTLQDFQDVNLELQTSPKSLFVNKSICAVQTVEGFKALIGSTYS
EWIFGYREGEDLVTLTTVGKGDHEKILKEKFNILLEKEFQPVNNPPDVKGAP
NT seq 879 nt   +upstreamnt  +downstreamnt
atgaatcttcctgaatattttgcaaggattggctatcagggtcaggacgacaaggcagat
gtggagacactcagaaggattcatgagcagcacactttagcaatcccatatgaaaacctc
agcattcactgcggggaagacattggccttgacctacagatgatctatgacaaaatagtt
aagaaaaagcgaggtggttggtgcactgaaaacaacggactgttctactgggtattaaag
gagatgggatacgatgttgtgatgttaggatcgcaagtgtacaactgcgaagataacatg
tactctgccaaagttgatcacctcgtgctcctgaccaccattgataataagccttaccta
agtgacgtcggatttggggtattgaagcagatgaggcaaccactggagttaacctcagga
aaagaccagcctcagcttcctggtgtctatcggctaactgaagaaaatggtgtttgggag
ctcgaaagatatggcagaaagctgcaggccgcagatgaaagctatgccaactcttctttg
ttcagtcgaagccctcaccagaaaatgtacaagttcacactcgcaacttgtaccttacag
gactttcaggacgtaaacctggagcttcaaacctcccccaagtccttgtttgtcaataaa
tccatttgcgctgttcagaccgttgagggcttcaaagccctcataggctcgacctacagc
gagtggatattcggctatagagagggcgaggatttggtgaccctcacgactgtcggcaag
ggagatcacgaaaaaatactcaaagagaagttcaacattttgctggagaaagaattccaa
ccggttaacaatcctcccgacgtgaaaggcgctccctga

DBGET integrated database retrieval system