KEGG   Callorhinchus milii (elephant shark): 103173106Help
Entry
103173106         CDS       T03088                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H2-like
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103173106
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmk03036]
    103173106
Enzymes [BR:cmk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103173106
Chromosome and associated proteins [BR:cmk03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103173106
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103173106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 103173106
NCBI-ProteinID: XP_007883964
LinkDB All DBs
Position
Un
AA seq 411 aa AA seqDB search
MGREAKMAAKPGAWCVPCLASIEILQELCREEELTCRALGISRNILNEYEVEYLCGYRKT
KGTDFYLVKWKGWPASTNTWEPRKHLRSVQLVRQFQEDKTRFLESLKGRRWASERPGKEA
EAMTYVIQKGKQRIALRRWEEELNRKKTHQGRVLVENEVDFELPPTDFHYINQYRPTPGI
ELDQEPLIGCDCLDCMQGKCCPEEAGAKFAFSERGQLCIEPGKPIFECNSSCHCGPQCPN
RVVQKGTRYDLCIFRTRDGRGWGVKTLQSIRKKSFVMEYVGEVITSEEADRRGQLYDSKG
VTYLFDLDYVEDEYTVDAGRFGNISHFVNHSCDPNLQVYNVFIDSLDTRLPRIALFSTRA
IKAGEELTFDYQMKGSGDTSINESSEVNGPARKLYRMVCKCGSASCRGYMN
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggggagagaggccaagatggcggcaaagcccggcgcttggtgtgtgccgtgcttggcg
tcgatcgaaattctacaggagctttgccgggaagaggagctgacctgccgggctctgggc
atcagccgcaacatcctaaacgagtacgaagtggagtatctatgcggctacaggaaaacc
aaggggacagatttctacctggtgaagtggaaaggctggccggcatccaccaacacctgg
gagcccaggaagcacctgcggagtgtgcagctggtcaggcagttccaggaggacaagacc
cggttcctggagagcctgaaggggaggcggtgggcgagtgagaggccgggcaaggaggcg
gaggccatgacctacgtgatccagaaggggaagcagaggatagcgctcaggagatgggag
gaggagctgaatcgcaagaagacccaccaggggagggtgctggtggagaacgaggtggac
tttgagctgccccccacggacttccattacatcaaccagtaccggcccacgccgggcatt
gagctggaccaagagcctctgatagggtgcgactgcctggactgtatgcagggcaagtgc
tgccctgaggaggcgggcgccaagtttgccttcagtgagcgagggcagctgtgcatcgag
ccaggcaagcctatcttcgagtgtaactccagctgccactgcggcccccagtgccccaac
cgggtggtgcagaagggcacccgctacgacctgtgtatcttcaggactcgcgacgggaga
ggctggggggtcaagacgctgcagagcatcaggaagaagagcttcgtcatggagtatgtg
ggcgaggtgatcacgagcgaggaggcggacaggagagggcagctctacgacagtaagggc
gtcacgtatctcttcgacctcgattacgtggaggacgagtacactgtggacgcgggcaga
tttggaaacatttctcactttgtgaatcacagctgtgacccaaatcttcaggtttacaat
gtttttatcgacagtttggacacccggcttccccggatagcgctgttctccaccagggcc
ataaaggcaggggaggagctcacctttgactatcagatgaaaggttccggcgatacctca
atcaacgagagctcggaggtgaatggcccagcccgaaagctgtacaggatggtgtgcaag
tgtggctctgcttcctgtcgcggctacatgaactga

DBGET integrated database retrieval system