KEGG   Callorhinchus milii (elephant shark): 103174016Help
Entry
103174016         CDS       T03088                                 

Definition
(RefSeq) maleylacetoacetate isomerase-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00350  Tyrosine metabolism
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103174016
Enzymes [BR:cmk01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     103174016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 103174016
NCBI-ProteinID: NP_001279486
UniProt: K4GJE6
LinkDB All DBs
Position
Un
AA seq 218 aa AA seqDB search
MASGAKPVLYTYFRSSCSWRVRIALALKGIEYEQVAVHLVKDGGQQHAEEFKVVNPMRQV
PALHIDGITISQSLAIIQYLDETRPGPQLLPQDSKKRAEVRMISDLIASGIQPLQNLAVL
HRVGEEQQEAWAHDFIVQGFAALERVLQDTAGRCCVGDEVTMADMCLVPQVFNATRRFKV
DMTPFPTIARISKALLELKAFKVSEPSCQPDTPAEQRA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggagctaaaccggtgctctacacctatttcaggagctcatgttcgtggaga
gttcgaatcgccctggctctgaaggggattgaatatgaacaggtcgcagttcatctggtc
aaagatgggggacagcagcacgccgaggagtttaaggttgtcaatcccatgaggcaggta
ccggctctccacatcgatggcatcactatctcccagtcgttggctataatccaatacctg
gacgaaacccggcctggacctcagctcctccctcaggacagcaagaagagggcagaggtt
cgcatgatatctgacctcatcgcctccggcatccagcccctgcagaacctggctgttttg
caccgagttggtgaggagcagcaggaggcctgggctcacgacttcattgtccagggtttt
gcagctctggagagagtccttcaggacacggccggtcgctgctgtgttggggatgaggtg
accatggctgacatgtgcctggtgccacaggtgttcaacgccaccaggaggtttaaagtg
gacatgactccgtttcccaccatcgcgaggattagcaaagctctgttagagctgaaggca
tttaaagtgagtgagccgtcctgccagcccgacacccccgccgagcagcgagcctga

DBGET integrated database retrieval system