KEGG   Callorhinchus milii (elephant shark): 103174269Help
Entry
103174269         CDS       T03088                                 

Definition
(RefSeq) alanyl-tRNA editing protein Aarsd1-B-like
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103174269
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmk01007]
    103174269
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmk03016]
    103174269
Enzymes [BR:cmk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     103174269
Amino acid related enzymes [BR:cmk01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   103174269
Transfer RNA biogenesis [BR:cmk03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    103174269
 Prokaryotic type
    103174269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pneumovirus_M2
Motif
Other DBs
NCBI-GeneID: 103174269
NCBI-ProteinID: XP_007884904
UniProt: A0A4W3GF53
LinkDB All DBs
Position
Un
AA seq 126 aa AA seqDB search
MASGRNGRETGTICPDITDSQEQARGLDGLGPLLVIPLTARSAPLPVPQVIKLLGTDKGK
KNKTNLIFLVGNRVLSYMDKCLATERALTSLLKNGPNEHVQGVDKLQKSVKLLHKVRRCR
WDLGVD
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgggaagaaacggcagagaaaccgggaccatctgccccgacataacagactcg
caggaacaggctcgcgggctggatggcctcggcccgctcctagttattcccctcaccgcc
cgctcggcgcctctgcctgtccctcaggtcattaagttgctggggacggacaaagggaaa
aagaacaaaaccaacctgattttcctggtcggcaaccgagtcctgagctacatggacaaa
tgcttagcaaccgagagagcgctaacttcgctcctcaagaacggcccgaatgagcacgtg
caaggggtggacaagctgcagaaatcagtcaagctcctgcacaaggtgaggcggtgtcga
tgggatctgggcgttgattaa

DBGET integrated database retrieval system