KEGG   Callorhinchus milii (elephant shark): 103174454
Entry
103174454         CDS       T03088                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04080  Neuroactive ligand-receptor interaction
cmk04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103174454
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103174454
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cmk04030]
    103174454
G protein-coupled receptors [BR:cmk04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    103174454
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srt
Other DBs
NCBI-GeneID: 103174454
NCBI-ProteinID: XP_007885060
LinkDB
Position
Un
AA seq 266 aa
MEQCFDNESVPFFYNNSRKTLSNHWRTKDKLVVALGLSVCVIVILANILVILAIIVNRRF
HYPIYYLLGNLAAADLFAGIAYLYLMFHTGPRTRELTVKTWFIRQGLIDTSLTASVANLL
AIAVERHQTVFQMQLHSTMSNQRVIILIVCIWVTAIIMGLIPMMGWNCVCDLTQCSIMAP
LYSKSYLIFWAVSNLVIFFVMLMIYTHIFIYVYGKTKRISKHTAFQPKHKETMMNLIKTV
AIILSECSPPPTRLPSLLHPLPTASS
NT seq 798 nt   +upstreamnt  +downstreamnt
atggaacagtgcttcgacaacgagagcgttccgttcttctataacaacagcaggaagacc
ctgagcaaccattggaggaccaaggacaagctggtggtagctctgggactcagtgtgtgt
gtgattgtcatcctggcaaacatcctggttatcctcgccatcattgtcaaccgtcggttc
cactaccccatctactacctgctcggcaaccttgccgccgccgacctcttcgccgggatc
gcttacctctacttgatgttccacacgggccctcggactcgcgagctgaccgtcaagacc
tggttcattcgacaagggctcatcgacaccagtctgacggcttcggtcgccaacctgctc
gccatcgcggtggaacggcatcagacagtctttcagatgcagctgcacagcaccatgagc
aaccaaagggtcatcatcctgatcgtctgcatctgggtcacggccatcatcatggggttg
atccccatgatgggctggaactgcgtctgcgacctgacccagtgctccatcatggccccg
ctctacagcaaaagctacctgatcttctgggcggtttccaacctggtcatcttcttcgtc
atgctcatgatctacacccacatcttcatctatgtctacggcaagaccaagaggatctcc
aagcacaccgccttccagccaaagcacaaggagaccatgatgaacctaatcaagaccgtg
gccatcatcctcagtgagtgcagccctccaccaacacgcttgccttccctcctccatcct
ctcccaactgctagctca

DBGET integrated database retrieval system