KEGG   Callorhinchus milii (elephant shark): 103174867Help
Entry
103174867         CDS       T03088                                 

Definition
(RefSeq) glycogen [starch] synthase, muscle-like
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00500  Starch and sucrose metabolism
cmk01100  Metabolic pathways
cmk04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103174867
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    103174867
Enzymes [BR:cmk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103174867
Glycosyltransferases [BR:cmk01003]
 Polysaccharide
  Storage polysaccharide
   103174867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_5 Glyco_transf_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 103174867
NCBI-ProteinID: XP_007885643
UniProt: V9KJN4
LinkDB All DBs
Position
Un
AA seq 713 aa AA seqDB search
MSFNDSFPALEDELPVDNLFLFEIAWEVANKVGGIYTVIQTKAKMTVDALGENYFLIGPY
FENSVRAQVELIDPPIPSIKRTIDCMNAKGCKMYFGRWLIDGSPYVVLIDISASSWMLDQ
WKTELWDTCNIGIPWFDKEANDAVLFGFLTTWFLGEFIAQCEDNPFILAHFHEWLSGVGL
LLSRIRKLQLATIFTTHATLLGRYLCAGNVDFYNNLQRFDVDKEAGTRQIYHRYCMERAA
VHCAHIFTTVSEITAMEAQHLLKRKPEVVTPNGLNIKKFSAMHEFQNLHARSKAVIQEFV
RGHFYGCLNFNLDKTLFFFIAGRYEFSNKGADVFLEALARLNYLLKVNQSDVTVVVFFIM
PAKTNNFNVETLKGQAVRKQLWDTANVIKEKFGKNLYESLLVGEMPDIKNMLDREDFTLM
KRAIYATQRTTLPPVCTHNMLDDSNDQILKAVRRIRLFNNATDRVKIIFHPEFLSSTSPL
LPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQQHIADPAAY
GIYILDRHVKSLDESCNQLTSFIYSFCQQTRRQRIIQRNRTERLSDLLDWKYLGRYYVHA
RQMALAKAYPDSFTSTLWEPEVSEGFCYPRPASKPPSPATSLHSSPYHSETEEEEDERYN
EEEEAEKDRKNIKPITSITRRSGKRHVRRNGSDSSRSLTSSDAENHSDQDTVE
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcaacgactccttccctgcccttgaggacgagctcccagttgacaacctcttc
ctcttcgagatcgcctgggaagtggccaataaagtgggtggaatctacactgtcattcaa
accaaagctaagatgactgtggacgcacttggcgagaactatttcctgattggaccgtac
ttcgagaacagcgtcagggctcaagtggagctgatcgacccacccatcccgtccattaaa
cgcaccatcgattgcatgaacgccaagggctgcaagatgtatttcggcagatggctgatt
gacggcagtccctatgtagtgctgatagacatcagtgcctcgagctggatgctggatcag
tggaagactgagctgtgggacacgtgcaatataggaatcccctggtttgataaggaggcc
aatgatgctgttctgttcggatttctcactacgtggtttctgggagaattcatcgctcag
tgtgaagacaaccccttcatcctggcccatttccacgagtggctgtcaggagtcggactc
ctcttgagtcgcatccggaagcttcaattggcgacaatcttcaccacccacgccacgctg
ctggggcgctatctctgcgcggggaacgtcgacttttacaataaccttcaacgttttgat
gttgacaaggaggcggggacgaggcagatttaccacaggtattgtatggaacgggctgcc
gtgcactgcgcacacatcttcaccacggtatctgaaatcacagccatggaagcacagcat
ctgctgaagagaaagccagaggtggtgacacccaatggactgaacatcaagaagttttca
gccatgcacgagttccagaacctgcatgcccgcagcaaggccgtgatccaggagttcgtc
agaggccacttctacggatgtctgaacttcaacctggacaagacgctattcttcttcatt
gctggaagatacgagttctcaaacaagggggctgatgtgttcctggaagccttggcacgt
ctcaattacctgctcaaggtcaaccagagcgacgtgacggtggtggtgttcttcatcatg
cccgcgaagaccaacaacttcaacgtggaaacactgaagggccaggcagtgcgcaagcag
ctctgggacacggccaatgtgatcaaggagaagtttggcaaaaacctttatgagtcgctc
ttggtaggtgagatgcctgacatcaaaaacatgctggatcgggaggacttcactctgatg
aagagagcaatatatgccactcagcgcaccacattgcctcccgtctgcacgcacaacatg
ctggatgattccaacgaccagatcctgaaagccgtccgaagaattagattgttcaataac
gcaactgaccgagtcaagatcatctttcacccagagttcctgtcatctaccagcccgctg
ctccctctggattacgaggagtttgtgcgcggctgccatctgggcgtctttccttcctat
tatgaaccgtggggatacactcctgcggagtgtacagtgatgggcatccccagcgtcacc
acaaatctctctgggtttggctgcttcatgcagcaacacatcgcagacccagccgcctat
ggcatttacatcctcgatcggcacgtgaagtctctggatgaatcgtgtaaccagttgacc
tcgttcatctacagcttctgtcagcaaacccggcgtcagcgcatcatccagaggaaccgc
actgagcgtctctcagacctgctggactggaagtacctggggaggtattatgtccacgcg
aggcagatggctttagccaaagcttatccagattcattcacatccactctctgggagcct
gaagtgagtgaaggtttctgctaccccagacccgcctccaaacccccgtctcccgccacc
tccctccactccagcccctaccacagcgagaccgaggaggaggaggacgagcgatacaat
gaagaggaagaggcggagaaagacaggaagaacataaagccaatcactagcatcactcgg
cgatcagggaagagacacgtgaggaggaatgggtctgactcgtcgcgaagccttacctcc
agtgatgctgagaatcacagtgaccaggacactgtggagtga

DBGET integrated database retrieval system