KEGG   Callorhinchus milii (elephant shark): 103175511Help
Entry
103175511         CDS       T03088                                 

Gene name
gaa
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00052  Galactose metabolism
cmk00500  Starch and sucrose metabolism
cmk01100  Metabolic pathways
cmk04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103175511 (gaa)
   00500 Starch and sucrose metabolism
    103175511 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103175511 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmk04147]
    103175511 (gaa)
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103175511 (gaa)
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103175511 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 103175511
NCBI-ProteinID: XP_007886783
LinkDB All DBs
Position
Un
AA seq 958 aa AA seqDB search
MSPSLCKAEKWAFASGREEIGLSGLPSVSEQRTCQFGALKCVTAFLIVALIYVIAYHNRS
TLNSLVTVKCVNVDKTEPRLWQYVHHGIGSVNTERLPEMSSNGSASQCSSDPFNRFDCAF
NKEMDMKKCLSRGCCYLPVDPANVSVPWCFFPSNYPTYKLDYLTPTPNGYAGKLSRAEKT
MFPKDVMTLQLNMMYETEARLHFTLKDPGNKRYEVPIAVPKVTERAPTQLYTVKFSSKPF
GIIIQRKSNGCVLLNTTVGPLFYADQFLQISTSLASKYISGLGEHMTNLILDVNWRRLTL
WNLDKAPDPRSNLYGSHPFYLVMEEDGSAHGVFLLNSNAMDVLLQPSPALTWRTIGGILD
FYIFLGPDPNSVVRQYMDIIGYPIMPPYWSLGFHLCRWGYSNTNITREVVENMTRANMPQ
DVQWNDLDYTYLKRDFTYNKLNFGDYPQMVEEFHQKGLKYVMIVDVGISSWQAAGSYKPY
DNGLKRGVFIKNETGQPLIGRVWPGPTAFPDFTNPETHSWWYENIKAFHDKVPFDGMWID
MNEPSNFINGAIVGCPDNTVENPPYVPGVTGGSLSSRTLCMSGKQYLSSHYNLHNMYGLT
EAIASHDALIRILGKRPFVISRSTFPSHGRYAGHWTGDIMSSWNHMYHTIPATMLFNMFG
IPLVGADVCGFHGNTNEELCVRWTQLGSFYPFMRNHNDLHQQSQEPYVYSKTAQAAMRKA
LFTRYSLLPFLYTLFHKAHSDGEMVVRPLSFEFPQDPNTLIIDRQFMWGKALLISPVLAP
KTVELSSYFPPATWYSLYDGSAIHSKGQYILLPAPLDTINVHVREGCILPLQEPNTTTTA
SRGNPLGLIVALSNREAARGELFWDDGDSLSTYENGDYTHIIFLARNNILFSQITRLNSQ
IDGVVLGTVSVFGVASPPLDVSVNGVWISDFSYRMDSKVLTLQNLSVLVGEEFTITWF
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgtctccgtcactttgcaaagcagaaaaatgggcctttgcctcaggaagagaagaaata
ggtctctctggacttccttctgtatctgaacagagaacatgtcaatttggggctcttaaa
tgtgtgactgcctttctgattgttgctctcatttatgtgattgcttaccataaccgttca
acgctgaattccttggtgactgttaaatgtgtgaatgtggacaagactgaaccacgcttg
tggcaatatgtacatcacggaatcggatcagtgaatacagagaggcttcctgagatgtcc
tcaaatggtagtgcctctcagtgcagttctgaccccttcaatagatttgactgtgctttt
aacaaagagatggatatgaagaaatgcctgtctcgtggctgctgctatttgccagttgat
cctgccaatgtgtctgtcccatggtgttttttcccatcaaactacccaacttacaaactg
gattatctcactccaacacccaatggttacgcaggcaagttgagccgtgctgaaaagaca
atgttccccaaagatgtcatgacacttcagttgaacatgatgtacgagacagaagccagg
ctccattttactcttaaggatccaggaaacaaacgctatgaggttcccattgccgttcct
aaagtcactgaaagagctccaactcagctgtacactgttaagttttcgtccaaacctttt
gggatcattatacagaggaaatcgaatggctgtgtactcttgaatacaacagtcgggccc
ctgttttatgctgaccagtttctccagatttctacctccctcgcatcaaaatacatctct
ggtctgggagaacacatgacaaacctgatcctcgatgtcaattggagacgattaactctt
tggaaccttgataaggcccctgatcctcgttccaatctgtatggctcgcaccctttttac
ttggtaatggaggaggatggatcagctcatggtgttttcctgctgaacagtaatgctatg
gatgtgctacttcagccaagccccgctctgacctggagaaccataggtggaatcctggat
ttttacatcttcctcggaccagaccccaactcagtggtcaggcaatacatggacatcatt
ggttatccaataatgcctccctactggagtcttggcttccatctgtgtcgctggggttac
tcgaacaccaacatcacccgggaggtagtggagaacatgaccagagccaacatgcctcag
gacgtgcagtggaatgacctggattatacctacttgaaaagggatttcacctacaacaag
ctaaactttggagactatccacagatggtggaggagtttcaccagaagggcctgaagtac
gtcatgatcgtggatgtgggcatcagcagctggcaggcagcagggtcctacaagccttac
gacaacgggctaaagagaggagtcttcattaagaatgaaaccggccaacccctaataggg
agagtctggccaggtccgactgctttccctgattttacgaacccggagacccacagctgg
tggtatgagaatatcaaggcatttcatgataaagtgccattcgacggaatgtggatcgac
atgaatgagccttccaactttatcaatggggcaatagttggttgtccagacaacacagtg
gaaaatcctccttatgtaccaggtgtgacaggaggaagcctgagctctcgcacgctgtgt
atgtctggaaaacagtacttgtcatcacattacaacctgcacaatatgtatgggctgact
gaggccatcgcttctcatgatgcattgatcagaatacttggaaagcgaccgtttgtgatt
tcacggtccacgttccccagccacggtcgctatgctggacactggacaggagatatcatg
agcagctggaatcacatgtatcacactatcccagcaactatgctgttcaacatgtttggt
atccctctggtgggagcggatgtctgcggtttccacggcaacaccaacgaggagctgtgt
gtgcgttggacgcagctcggatcgttttatcctttcatgcggaatcacaatgatctacat
cagcagtctcaagaaccgtacgtctacagtaagacagcgcaggcagcaatgaggaaagct
ctgttcaccagatactcactgctgcctttcctctacaccctcttccacaaagcacactct
gatggcgaaatggtggttaggccgctgtcgtttgagtttcctcaggacccaaacacattg
ataatcgatcggcagtttatgtgggggaaggcgctcctcatcagtccagtattagcaccc
aaaacagtagagctctccagttatttccctcctgcaacatggtacagtctctatgatggt
tctgctattcacagcaagggacagtatatcttactgccggcacccttggatacaataaat
gttcatgtacgagaaggttgcattttacccttacaggaacccaataccacgaccacagca
tcccgtgggaacccgcttggcctgatcgtggcactgtccaatcgggaagcggccagggga
gagctgttttgggacgatggagatagcctatcgacgtacgagaatggcgactacactcac
attatcttcctggccagaaacaacatactgtttagtcagataacccgtttgaacagccag
atagatggtgtggtgctgggcacggtgtctgtgtttggagtggcatctccccctctcgat
gtgtccgttaatggagtctggatctctgacttttcctacagaatggattcaaaggtgctg
accctgcaaaatctctctgttcttgtgggcgaagagttcacaatcacatggttctga

DBGET integrated database retrieval system