KEGG   Callorhinchus milii (elephant shark): 103175535Help
Entry
103175535         CDS       T03088                                 

Gene name
si
Definition
(RefSeq) sucrase-isomaltase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00052  Galactose metabolism
cmk00500  Starch and sucrose metabolism
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103175535 (si)
   00500 Starch and sucrose metabolism
    103175535 (si)
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     103175535 (si)
    3.2.1.20  alpha-glucosidase
     103175535 (si)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103175535
NCBI-ProteinID: XP_007886824
LinkDB All DBs
Position
Un
AA seq 1826 aa AA seqDB search
MGCRKKYSGLESSLVVVCLIAFVVAVVLIALLATGEPGTCRSVKAEVPFAADCPSSVPNG
DRINCFPDGGATLKKCEERGCCWKPIEDRNVPWCFFSKNQGYTAQNNQVKTRAGFQVHLK
RMPSPFPFGNVVENLVLTGEEQTENRFRFKITDSSKRRFEVDHENIKPFTGKAVSNPNYE
VSVNQNPFGIKITRKSTKTVLFDTSVGPLQFADQFIQITAKLPTHNIYGLGEHVHKQYRH
DTYWKTWPIFARDAFPNGNMDNLYGHHTFFMCLEEESGLSFGVFLLNSNAMEVELQPTPA
ITYRTIGGVLDFYIFLGSSPEHVVQEYLTLVGKPMMPAYWILGFQLSRWGYKDLDEVLAT
VERNRKIDLPYDTQIIDIDYMENKKDFTYDKVNFKNLPSFADNLHDNGQKFILILDPAIS
TEKLINGPYETYDRGTKMGVWINESDGKTPIVGEVWPGETVFPDYTNPQCIKWWLDECER
FYKEVKFDGIWIDMNEVSSFKQGSKKGCNSNQWNHPPFIPRIVDNVMYFKTVCMDAKQTA
GIHYDVHSLYGHSMTLATEEVIKKIFPNKRSAILSRSTFAGSGKYTGHWLGDNGANWNDM
KWAIPGMLEFNLFGFPYIGADICGFFGNADEDLCSRWMQVGAFYPFSRNHNAEGYKPQDP
AFFGETSLLVNTSRHYLNIRYTLLPYLYTLFHEAHVNGSTVVRSLLHEFPSDNQTWTVDR
QFLWGPALLISPVLDPKTTKIQAYFPDAVWYEYETGGSIFSQKQWVTLQLPEDKLGLHVR
GGFVFPTQQPANSTFYSRKNPMGLLIALDEQGRAEGRLFWDDGESRDTFEKEQYISYRFS
VAQDVLKLEVLKNGYKDPNNLQFEEITILGLQYLPRNVTVKKGADEIVIPESDIDYDKST
KVTLIKGLQLVLGEAYTVEWKSTPRDVEKINCNPEGYITEEACKNRGCQWDELPHKSEVP
SCFYPYDYGYQIDSSYGIVKSQARMSTQVKRNTKYPERFKGQTPTIEVLKIEVTSLNQHM
LNFKIFDPKEKRYEVPIPLNIPNVPANETFEQLYDVQLTYNPFGIMVKRKSSNAVIWNSQ
VGGFTFTDQFIQISTSLPSENIYGLGETEHSSFKLDLNWNTWGMFAKDQPPGHQLNSYGS
HPFYMCLENDANAHGVFLFNSNAMDVTLQEAPTLTYRILGGILDFYVFLGPTPEMVVQQY
TELIGRPVLPPYWSLGFQLCQYGYKNIEEVATLYKNMKKARIPYDVQYFDIDYMERQLDF
TIDKDDFATMPQLVNEMKAERMRIVIILDPAISGNETVPYKAFTSGLDNDVYIKWKNSSD
IVWGKVWPDFPNVTVDSSKDWDYQVKHYRSFAAFPDFFRNETKEWWFAAIKEFYDNPDNP
SASVKFDGLWIDMNEPASFVHGSVNDCKDEKLNNPPYMPDLESRSMGLNHKTLCMESEQI
LPDGTSVRHYDVHNLYGWSQTQTTLDSLQKVTGERGLVVTRSTFPTSGQWSGHWLGDNTA
SWDQMHKSIIGMMEFSLFGISYTGADICGFFQNTTYELCLRWSLLGAFYPYSRNHNSIGT
RPQDPTSWDETFENHTRNVLETRYMLLPYLYTLLYDAHVSGSTVIRPLLHEFYADKSTWD
IDEQFLWGAAIMITPVLKMGATNVTGYIPNTRWYDFKTKKEINVRGKWLEMPTPLEHINL
HVRGGYVIPWQSPANNTYYSRKEYMGLFVALDDNSQAEGHIFWDDGQTIDSVAKEEYFLG
TFSVKQNVLTTAIKQNHIKSTASELKLAVVEVWGIENTPIASVTAHYNGTDHQINDFSVT
EQTLIIQMVKNDFYIDQPLRITWKTT
NT seq 5481 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcagaaaaaagtattctggtttagaatcctcacttgttgttgtgtgtctcatc
gcttttgttgtggcggtcgttttaattgcacttttggccactggggaacctggaacctgt
agatcagtcaaagctgaagtaccctttgcagcagactgtccatcctctgttcccaatggt
gatcgaattaactgtttccctgatggaggtgctactttgaaaaaatgtgaagaacgaggc
tgctgttggaaaccgatagaagatagaaatgtgccctggtgcttcttctcgaagaatcag
ggatacacagctcagaataaccaagtcaaaacacgagcagggtttcaagttcacttgaaa
cgaatgccttctcctttcccttttgggaatgttgttgaaaacttagtgttgactggggaa
gagcagacagaaaatcgtttccgattcaagattaccgattctagcaagagacgatttgaa
gttgatcatgaaaatatcaagcctttcactggtaaagcagtgtcgaatccaaactacgaa
gtcagtgttaatcagaatccttttggaatcaaaatcaccagaaagtccacaaaaactgtc
ttgtttgatacttcggtgggacctttgcaatttgctgatcaatttatacaaataacagcc
aaacttcccacacacaacatctacggactaggagagcacgttcataaacagtaccgtcac
gacacgtactggaaaacctggcctatcttcgccagagatgctttccctaatgggaacatg
gacaatctctatggccaccacacattttttatgtgtctggaagaggagagtggattatcc
tttggtgtgtttttgctgaatagcaatgccatggaggttgaactgcagccaactccagca
ataacatatcgaacaataggtggagtcctggatttttacatcttcttgggttcttcacct
gaacatgttgttcaggaatacttaacgctggttggcaaacccatgatgccagcatactgg
atcctgggattccaacttagtcgctggggttataaagatcttgatgaggttttggcaaca
gtggagaggaaccgcaaaatagacctgccatatgatacccaaatcattgatatcgattac
atggagaacaagaaggattttacttatgataaagtgaatttcaaaaatctcccaagtttt
gctgataacttacatgacaatggacagaaattcatcctcattttggatcctgcgattagc
accgaaaaactgataaatgggccgtacgaaacatatgatagaggcacaaagatgggtgta
tggattaatgaatctgatggaaagacgcccattgtaggagaggtgtggcccggggagacc
gtctttcctgactacacaaacccgcagtgcattaagtggtggctggatgaatgtgaacgg
ttctacaaagaagtaaaattcgacggaatctggattgatatgaacgaggtgtccagcttc
aagcaaggttcaaagaaaggatgtaatagtaaccaatggaaccatccacctttcatccca
aggatcgttgataatgtaatgtacttcaagaccgtttgcatggatgctaagcaaactgca
ggaattcattatgatgtccacagtctatatggtcactcaatgacactggcgactgaagaa
gtgattaaaaagatcttccccaacaaacgaagtgctattctttcccgatcaactttcgcc
ggatcaggaaaatatactggacactggctgggagataacggagcaaattggaatgacatg
aaatgggcaattcctggaatgctggagtttaacctttttggctttccctacattggagct
gatatttgtggcttcttcggtaatgcagatgaagatctttgcagtcgctggatgcaagtt
ggagcattttatccattttccaggaaccacaatgctgagggatacaagcctcaagatcct
gctttttttggtgaaacgtcccttctagtgaacacatcaagacattacctgaatatccga
tatacattgctgccttacctctacactctcttccacgaggctcacgtcaatggaagcaca
gtggttcgttcattgcttcatgagtttccttcagacaatcaaacatggactgtggaccga
cagtttctctggggacctgctcttctcatcagcccagtgctggatcctaagacaacaaaa
atacaagcttactttcctgatgcagtttggtatgaatatgagacgggtggctccatattt
tctcaaaagcaatgggtaactctgcaactaccagaagataaattaggacttcatgtcaga
ggtggctttgtcttcccaactcagcaaccagctaactctacattttatagtcggaaaaac
cccatgggtcttcttattgcgcttgatgagcaaggaagggctgaagggcgattgttctgg
gatgacggggaatccagagatacattcgaaaaggaacaatatatctcctatcggttttca
gtagcgcaggatgttttaaaactcgaagtgttaaaaaatggatataaagatccaaacaat
cttcaatttgaagaaattacaatcctcggtctccaataccttccaagaaatgtcactgtg
aaaaagggagctgatgagatcgttatacctgaaagcgatattgactatgacaagtcaact
aaggttactcttataaaagggcttcaacttgtactaggagaggcatatacagtagaatgg
aaatccacaccgcgggatgttgagaagattaattgtaaccctgaaggatatataactgaa
gaagcctgcaaaaatcgtggttgtcaatgggatgagttgcctcacaaatctgaagtgcct
tcctgcttctacccatatgactatggttatcaaattgattcaagctacgggatcgttaaa
tcacaagccagaatgagcacacaagttaaacggaacacaaagtatcctgaacgcttcaag
ggccagaccccgactatcgaagttctaaagattgaggtcacgtccctgaatcagcacatg
ctgaattttaagatttttgatccaaaagaaaagagatatgaagttccaatcccgcttaac
atcccaaatgttccagcaaacgaaacctttgaacaactttatgatgtacaattaacctat
aatccatttgggattatggttaaaagaaagagcagcaatgcagtaatctggaattctcaa
gttggaggcttcacgtttactgatcagttcatccagatttcaaccagccttccttcagaa
aatatttatggacttggagaaactgaacattctagcttcaagcttgatcttaactggaat
acttggggaatgtttgccaaggaccaacctcctggacatcaattgaacagctatgggagc
catcctttttatatgtgtctcgagaacgatgccaatgcccacggtgtgttcctgttcaac
agcaatgcaatggatgtaacactgcaagaggctcctactctgacatatcgtatccttgga
ggaatcctggacttctatgtctttctcggtccaaccccagaaatggttgttcaacagtac
accgagcttattggtcgcccggttctgccaccatactggtccctaggattccagttatgt
caatacggatacaagaatattgaagaagtagctaccttatacaaaaacatgaagaaggca
cgaataccatacgatgtgcaatattttgacattgattacatggagcgccagctggacttt
acaattgataaggatgattttgcaactatgccacaactggttaacgaaatgaaagctgaa
agaatgcgaatcgttattattttggacccagcaatttccggaaatgaaacagtgccatac
aaagccttcaccagcggattagacaacgatgtatacattaaatggaaaaatagttctgat
attgtgtggggaaaggtatggccagattttccaaacgtgactgttgacagctcaaaagat
tgggattatcaagtgaagcattatcgctcattcgctgcgttcccagatttcttccgcaat
gaaacaaaggagtggtggtttgcagcaataaaagaattttatgacaatccagacaaccca
agtgcaagtgtcaagttcgatggactgtggattgacatgaatgaacctgcaagttttgtt
catgggtctgtgaatgactgtaaagatgaaaaactgaacaaccccccttacatgccagat
cttgaatcaaggagcatggggctcaatcacaagaccctgtgtatggaaagtgaacagatc
ctacctgacgggacatcagtcaggcactacgatgtacataatctttatggatggtcgcaa
acacagacaacactggattcgttgcagaaagtaactggagaacgaggccttgtggtgact
cgttcaacattcccaaccagtggccagtggtctggacattggcttggagacaacacagcc
agctgggaccaaatgcacaaatcaatcattggaatgatggagttcagtctgtttggaata
tcctatactggagcagatatctgcggcttttttcaaaacaccacctatgaactgtgtctt
cgatggtcgctccttggagcattttatccctattcaaggaaccacaattcaataggaaca
aggccccaagatcctacatcctgggatgaaacatttgaaaaccatacaagaaatgttcta
gaaacacgttacatgttgttgccgtacctctacacactgctgtatgatgctcacgtcagc
ggcagcactgtgataagaccattgctgcacgagttttatgcagacaaatcgacgtgggat
atcgatgagcagttcctttggggtgcagcaataatgattactcctgtacttaaaatgggg
gcaactaatgtaactggttacattcccaacactcgctggtatgattttaagacgaaaaaa
gagatcaatgtgagaggaaagtggctggaaatgcccacaccacttgagcacattaatctt
catgttagaggtggctatgttattccctggcaatcaccagcaaacaacacatattatagc
cgaaaagagtatatgggactatttgttgccttggatgacaatagtcaggccgaaggtcat
attttctgggatgatggacagacaattgattcagttgcaaaagaagaatacttcctaggt
acctttagcgttaaacagaacgttttgacaaccgccataaagcaaaaccatatcaagagc
acagcaagcgagctgaaactggcagttgtcgaagtctggggaatagagaacacccctatt
gcaagcgttactgcccattataatggcacagaccatcaaatcaacgattttagtgtcacg
gaacagacactcatcatccaaatggtcaaaaacgatttctatattgaccaaccattgcga
atcacttggaaaacaacatga

DBGET integrated database retrieval system