KEGG   Callorhinchus milii (elephant shark): 103176030Help
Entry
103176030         CDS       T03088                                 

Gene name
marveld3
Definition
(RefSeq) MARVEL domain containing 3
  KO
K21099  MARVEL domain-containing protein 3
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04530  Tight junction
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103176030 (marveld3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmk02000]
    103176030 (marveld3)
Transporters [BR:cmk02000]
 Other transporters
  Pores ion channels [TC:1]
   103176030 (marveld3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL
Motif
Other DBs
NCBI-GeneID: 103176030
NCBI-ProteinID: XP_007887563
UniProt: A0A4W3J1Y1
LinkDB All DBs
Position
Un
AA seq 405 aa AA seqDB search
MAQSTRHPEHSSDKYSVKDEKDHYPKERHRDHRHRDDRSRPSREHRKYPDHDSRSTQDGD
HSKPKHNRDREKRREREKRHDDRNAHPREDRHRSERDYREREHREREHHRRDDHYNKPER
EHHSQTYSRSADDNHQHYKNEKRVPFPDDHVSHRNDRSIATVPVEYVEAEDHTTPSEMHY
FEPDYSEGILNFFKCRYLCTSRGLCQLVEVLLNLLILVCGAISYAGTGGYTDLSSLGSLY
YYSFGSAYSGFQGAEAEKVNQLDAEFYRLKLPTVTATMAYSGALMTFACLLLVLGVARIP
WRFPILLIIECGLDIVIGFAYIPALYFYFQHLIEGYNSAVCKERMSMYKSKGYDGFNCSL
HGADIAAGLCAALAVIVYELNAFADILAFRTVKKLKGENKENYGV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatcaacaagacacccagaacacagcagtgataagtattcagtaaaagatgaa
aaagatcattatcccaaagagcggcaccgtgatcaccgtcatcgtgatgatcgttcccgt
cccagtagggaacacagaaagtatccggatcatgacagcagaagcactcaagatggggat
cattctaaaccaaaacataatagagaccgcgagaagaggagagagcgagagaaaagacat
gatgatagaaacgctcatccaagggaagaccgacataggagtgagagggattatcgtgag
agggaacatcgtgagcgggaacaccatagaagggatgatcactacaacaaaccagagaga
gagcatcattctcaaacttacagtcgttcagcagatgataatcatcagcattacaaaaat
gaaaaaagagttcctttcccagatgatcatgtttctcatagaaatgacagatctattgca
actgtaccagtggaatacgtagaggctgaagaccacacgacaccatctgaaatgcactac
tttgagcctgactattcagaagggatcttgaatttcttcaaatgtcgatacctttgcaca
agtcgaggtctttgtcagttggtggaggtgctgctgaatctcttaattctggtgtgtggg
gcaatctcctacgctggcactgggggctacacggacctgtccagtctgggaagcctttac
tactactcttttggatcagcgtatagtggatttcaaggagcagaggctgaaaaagtaaac
caactggatgctgaattttaccggctgaagttgccgacagtcacggccacaatggcatac
agtggagccctgatgacttttgcgtgccttctattggttctaggtgtggcacggatacct
tggcgatttccaatcttactgattattgaatgtggactggacatcgtgataggttttgcc
tacatacctgcgctgtatttttatttccaacacctaatagaaggctataattcagcagtg
tgcaaggaaaggatgagcatgtacaaaagcaaaggatacgatggatttaactgtagtctg
catggtgctgacattgctgctggtttgtgtgctgccctagcagttatagtatatgaactc
aatgcatttgcggatattttagcatttaggacagttaaaaagctaaagggggaaaataag
gaaaattatggtgtgtag

DBGET integrated database retrieval system