KEGG   Callorhinchus milii (elephant shark): 103176334
Entry
103176334         CDS       T03088                                 

Gene name
tgfbr2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04010  MAPK signaling pathway
cmk04060  Cytokine-cytokine receptor interaction
cmk04068  FoxO signaling pathway
cmk04144  Endocytosis
cmk04218  Cellular senescence
cmk04350  TGF-beta signaling pathway
cmk04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103176334 (tgfbr2)
   04350 TGF-beta signaling pathway
    103176334 (tgfbr2)
   04068 FoxO signaling pathway
    103176334 (tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103176334 (tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103176334 (tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    103176334 (tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103176334 (tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmk01001]
    103176334 (tgfbr2)
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103176334 (tgfbr2)
Protein kinases [BR:cmk01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103176334 (tgfbr2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr ecTbetaR2 Pkinase CitMHS TMEM154 DUF2615 DUF5305 SIT CrgA
Other DBs
NCBI-GeneID: 103176334
NCBI-ProteinID: XP_007887981
LinkDB
Position
Un
AA seq 597 aa
MAVPVAVAVAVAVAMAVAVAVAMAVAMAVAMAVVVAVAMAVAVAVAAHVECLPQTLNLPT
LFRSIGDRSPFILHKLCMFCDVMPTNCSNSGTCKSKCDKTSICAEDGEVCVSIWRKQDNN
TIVETLCHHPSRRLHGHLLDDYNNTKCLMKKKEDEFYMCSCSEDECNDILDFSTEPKGDE
HQWMKVIMILMTLLILAIAVIVVFYWYRVQRRKKLNKEWAKERKHKSGRHIHRSDGCTIN
LKDDQSDISSTCANNINHNTELLPIELDVVVGKGRFSEVYKAKLKQNASEQFETVAVKIF
HFDEYASWKNEKDVFSDVNLKHENVLQFLTAEERDTEMGKQYWLITAYHTQGNLQDYLMR
HIISWEDLCLLGASLARGIAHLHSEYTMCGRPKIPIAHRDLKSSNILVKNDMTCCLCDFG
LSLRLDSSLSMDDLANSGQVGTARYMAPEVLESRMNLEDIEAFKQSDVYSMALVLWEITS
RCTAIGEVKDYEPAFGSKVREHPCVESMKDVVLRDRGRPEIPNSWNNHQLVQLVCEIIIE
CWDHDPEARLTAQCVVERFNDLEQMDKLSGRSCSEEKIPEDCSVSETKQDLRAVTVV
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggcagtgcctgtggctgtggcagtggcagtggctgtggctatggcagtggctgtggca
gtggctatggcagtggctatggcagtggctatggcagtggtagtggcagtggctatggca
gtggctgtggcagtggctgcccatgtggaatgtttaccccaaacattaaaccttcctacc
ctcttccgttcaataggggacagatcgccattcatcttacacaagctgtgcatgttctgc
gacgtcatgcctactaattgcagcaacagtggcacgtgcaaaagcaagtgcgacaagacc
tctatctgcgcggaagatggtgaagtctgcgtatccatctggagaaagcaagataacaat
acgattgtggaaacgctgtgccatcatccgtcacgacgcctgcatggccacttgctggat
gactacaacaatactaaatgtttgatgaagaagaaggaagacgagttctacatgtgctcg
tgctctgaggatgaatgcaatgacattctggatttctcaactgagcccaaaggagatgag
caccagtggatgaaggttataatgatcctcatgaccctgctcattctcgctattgcggtc
atcgtggtcttttactggtaccgggtgcagagaaggaagaagctgaacaaggagtgggcg
aaggagcgcaaacacaagtccggccgccacattcaccgcagcgatggctgcaccattaac
ctcaaagatgatcagtcagacataagctccacctgtgccaacaacatcaatcacaacact
gagctgctgcccatcgagctggatgtggtggtgggcaagggccgcttctctgaggtgtac
aaggccaagctgaagcagaacgcctcagagcagttcgaaacggtggcggtgaagattttc
cacttcgatgagtacgcctcgtggaagaacgagaaggacgtgttctccgacgtcaatctg
aagcatgagaatgtgctgcagttcctgacggcggaggaacgcgacacggagatgggcaaa
cagtactggctgatcacagcctaccacacccaaggcaacctgcaggattacttgatgcgt
cacatcatcagctgggaggacctgtgcctgctgggcgcctcgctggccaggggcatcgcc
cacctccacagcgaatacaccatgtgcgggaggcccaaaatcccgattgctcacagggac
ctgaaaagctccaacattcttgtgaaaaacgacatgacctgttgtttgtgtgactttgga
ttatctttgcggctggattcgtcactctcgatggatgatttagcaaacagcggacaggtt
gggacagccagatacatggcacctgaagtgctagaatccagaatgaacttggaggacatt
gaggcattcaaacagtctgatgtctactcgatggcattagtcctgtgggagatcacatca
cgctgtacagctataggggaagtcaaagactacgagcctgcctttggttccaaggtgcgg
gaacacccctgtgtggaaagcatgaaggatgttgtactgagagaccggggaagacctgag
atccccaatagctggaataatcaccagcttgtacaattggtgtgtgaaatcattatcgaa
tgctgggaccatgatccggaggcccgactgacagcgcagtgcgtagtggagcgcttcaat
gatctagaacagatggacaaactctctggtcggagctgctccgaggaaaaaatcccagag
gattgttctgtcagtgagaccaagcaagacctaagggcggtcactgtggtgtag

DBGET integrated database retrieval system