KEGG   Callorhinchus milii (elephant shark): 103176397Help
Entry
103176397         CDS       T03088                                 

Gene name
slc12a8
Definition
(RefSeq) solute carrier family 12 member 8
  KO
K14428  solute carrier family 12 (potassium/chloride transporters), member 8
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmk02000]
    103176397 (slc12a8)
Transporters [BR:cmk02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   103176397 (slc12a8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-GeneID: 103176397
NCBI-ProteinID: XP_007888084
LinkDB All DBs
Position
Un
AA seq 762 aa AA seqDB search
MEEVLMDWNFVSNSKVEDKPILFQNGSSGSQNVRHVQELFHEDAQVSQSQVKPWWKVQIF
VWEPVLFGTWDGVFTSCMINIFGVVLFLRTGWLVGNTGVLLGMFMVTLVVSVALVTVLSG
IGVWERCSLGSGGVYSMLSTVLGGRVGGTFGLLYVFGQCVTGAMYITGFAESIADLLDLS
NIWAVRGISIAVLMGLLGINLAGVKWIIRLQLLLLAMLAIATMDFVIGTFSHLDPDYGFV
GYSEELLRNNTLPDYSPEESFFTVFGVFFPTATGVMAGFNMSGDLQKPASNIPIGSLAAL
GISWFLYLVFVFLLGAICTREALRFDFMIAEKVALVGLLWLLGLYISSLASCMGSLYGAP
RILQCIAQERVIPVLGFLGQGKGPNKTPIAAICLVGLVTMAFILIGQVNVLAPIVTINFM
LTYSAVDYAYFSVCMSYDIQQNAKAQHKDISRSPRTSQPLILDRPQNYGTDGPIRGSTNG
SLLEFNKDMSQIFHPMVSQDKQEKMKKNRRKEKTLNRSVRLKKVRKPAKETLQDSFMLDF
DNSNTTVKEDNDLVSEGKAVGDLANQGPEDQELQDLSTSVGPQTLEANQNGNNYVTASTE
QYFTDVEDSLEPRRYGSTERQKSQETEIYAMPTSFYSKLCNHWLSFIGAIISIVIMFVIH
WIYALMNIAMALFTYFYIGQMSPGLPLGLANDFNFFRWIQEVFKNLQRKRPAYEKQIVMP
PPFTTVGMATTQLTEENADFASRDRYHCSSVISREDLSRQLN
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggtgttgatggattggaatttcgtgtccaattcaaaggtggaggataaacca
atcttgtttcaaaatggttcaagtggatctcaaaatgttcggcatgtacaagagcttttc
cacgaagacgcacaggtttcgcagtcccaagtgaagccctggtggaaggtccagattttt
gtctgggaacctgtgctgtttggaacatgggacggagtctttacttcctgtatgatcaac
atctttggtgttgttctgttcctgcggaccgggtggcttgtgggaaatactggcgtcctg
ctgggaatgttcatggtgaccctggttgtctcggttgctctggtgacagttctatctgga
attggggtgtgggaacggtgcagtctcgggagtggtggagtgtattcgatgctctctaca
gttttgggaggtcgtgtagggggaacctttggacttctctacgtgtttggacagtgtgtt
acaggtgctatgtacatcacaggctttgcagaatccattgctgacttgttggatctcagt
aacatctgggcagtgcgagggatttccattgctgtgctgatgggattactgggaattaat
ctcgcaggcgtcaaatggatcatccgacttcagctactgttacttgcgatgctggctatc
gctaccatggattttgttattgggactttctcacacttagacccagattatgggtttgtg
ggatacagtgaggagttacttcggaacaacacgttaccagactatagcccagaagaaagt
ttcttcactgtgtttggtgttttctttccaactgcaacgggggtaatggctggattcaac
atgagtggagacctacaaaaacctgcttccaacatccccattgggtcgttggcagctctg
ggcatctcatggttcctgtatttagtgtttgtttttttactgggagccatttgtacaagg
gaggcactccgatttgatttcatgatagccgaaaaggttgctttagtgggtctgctttgg
ctgctcggactctacatttcctctttagcctcctgtatggggagcctttatggagcacct
cgaatccttcaatgtatcgcacaagaacgagtgatccctgtccttgggtttctgggccaa
gggaaagggccgaacaaaactccgatcgctgcgatatgtctggttggacttgtgacaatg
gcttttatcctcattggccaagtcaatgttcttgccccgattgtcaccataaactttatg
ttgacttacagcgcggtggattatgcctatttctcagtgtgcatgagttatgacatccag
cagaatgcaaaggcacagcataaagacatttccagatctcctcggacttcacagcctctg
attttagataggccgcagaactacgggactgacgggccaattagaggcagtacaaacggg
tcattgctggagttcaacaaggatatgagccaaatcttccaccctatggtgtcgcaggac
aaacaagaaaagatgaagaagaataggaggaaagagaagactttaaatcgctctgtccga
ttgaaaaaagtgcggaaacctgcgaaggagacattgcaggacagttttatgctagatttc
gataactcaaatactactgtgaaagaagacaatgatctggtgtcagaggggaaggctgtt
ggtgacttagcaaaccaggggccagaggaccaggaactccaggatctttcaacttctgtt
ggccctcagactctagaagccaatcaaaatgggaacaactatgtaactgcatctacggaa
cagtatttcacagatgtggaagactcgttggaaccgagacgttatggttccactgaaagg
cagaagtctcaggaaacagaaatttacgcaatgccaacatcattttattctaagctttgc
aaccactggctttcattcattggtgcaataatatcaatcgtaatcatgtttgtgattcac
tggatttatgccttaatgaacatagcgatggcattgttcacctacttctacattggccag
atgagccctggactgccgcttggtttagccaacgacttcaatttcttccgatggattcag
gaagtcttcaaaaatttacaaaggaaaagaccagcctacgaaaaacagattgtaatgccc
cccccatttacaactgtcggaatggcgaccacacaactgacagaagagaacgctgacttt
gcctcgcgcgaccgctaccactgttcctcagttatcagcagagaagacctcagtcgccaa
ttgaactga

DBGET integrated database retrieval system