KEGG   Callorhinchus milii (elephant shark): 103176409Help
Entry
103176409         CDS       T03088                                 

Gene name
gpd2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103176409 (gpd2)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     103176409 (gpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 FAD_binding_2 EF-hand_1 FAD_oxidored EF-hand_6 GIDA EF-hand_8 Pyr_redox_2 NAD_binding_8 HI0933_like Pyr_redox Thi4 EF-hand_9 Pyr_redox_3 FAD_binding_3 TPR_20
Motif
Other DBs
NCBI-GeneID: 103176409
NCBI-ProteinID: XP_007888108
LinkDB All DBs
Position
Un
AA seq 728 aa AA seqDB search
MAFRKIAKGTFLLGGGALTAVFGLSQLPEPKNKSHHVLNAHVVGNNGGDFQNGLPSRADQ
VASLQSTTEFDVLVVGGGATGCGCALDAVTRGLKTALIEREDFSSGTSSRSTKLIHGGVR
YLQKAFTNLDYEQYKLVKEALRERANLLDIAPHISKPLPILLPVYKWWQLPYFWFGIKVY
DLVAGSQCLKRSYIISKSSALELFPMLKKDQLKGAIVYYDGQHNDARMNLAIALTAARYG
AAIANYVEVMHLLKKMDPDTGIEHIYGARCKDIQTGKDFDVKAKCVINATGPFTDSLRKM
DDADIPNICQGSAGVHIVMPGYYSPENMGLLDPATSDGRVIFFLPWEKMVIAGTTDSLTE
VVQNPVPREEDINFILSEVRNYLSQDVEVRRGDVLAAWSGIRPLVTDPTSKDTKSICRNH
LVAVTKSGLVTIAGGKWTTYRLMAEDALNAAIKTHGLNPTASCQTVGLLLEGAVGWTPTL
YIRLVQDYGLSTEVSRHLSNTFGTKAFEVAKLAKVTGKRWPIVGKRLVAEFPYIEAEVTY
AVKEYACTAIDVIARRTRLAFQNIQAAEEALPRIVEIMAAELNWNEQKKQEELVSALRFL
YLEMGYKVRDEQLTKTTEVNLTPEELDRFTIRFRKFDNQQRGFITFVDVQRVLETIDHDI
DENALHEIVNEVDLNKNGQVELHEFLQLMSAVKKGSVSSSRLAILLKRAEEKLDHREAIP
VHRSGGGV
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcgaaagattgcaaaagggacctttcttttgggaggcggtgctctcacagca
gtgtttgggctttcacaattaccagaacccaagaataagagccaccacgttttgaatgct
catgtggtaggaaataacggaggcgatttccaaaatggtttaccatcaagagcagatcag
gtggcttctctgcaaagtaccacagagtttgatgtccttgtggttggaggaggggcaaca
ggatgtggctgtgctctggacgccgtgactcggggtcttaaaaccgcactgatagagaga
gaggacttctcatcagggacaagtagcagaagcacaaagttgatccacggtggagtgcga
tacctgcagaaagcattcacgaatcttgactacgaacagtataaattagtgaaagaagca
ctccgtgaacgggccaacctgctcgacattgccccacacatttccaaaccgctgcctatt
ttgcttcctgtgtacaaatggtggcagctgccttacttctggtttgggataaaggtatat
gacctcgtggctggaagtcagtgcttgaaaagaagttatatcatcagcaagtcaagtgct
ctggaacttttcccaatgctgaagaaagaccagcttaaaggagctattgtgtactatgat
ggacaacacaatgatgcacggatgaaccttgcgatcgctctcactgctgccaggtatggt
gctgccatagccaattacgttgaagtgatgcaccttctgaagaagatggatccagacact
ggcatagagcatatctatggtgctaggtgcaaggatattcaaacagggaaagattttgat
gtgaaagccaagtgtgttatcaatgctacaggaccgttcacagactctctgcgtaaaatg
gatgatgctgacatcccaaacatctgccagggtagtgctggtgtacacattgttatgcca
ggttattacagccctgagaacatgggattactggatccagctactagtgatggtcgggtt
atatttttcttaccctgggagaaaatggtcatcgcaggaaccactgactctctgacggaa
gtggtacagaaccctgtcccccgcgaggaagatattaatttcattctctccgaagtacgg
aattatctcagccaggatgtagaagtgagacgaggagatgttctcgcagcttggagtggt
atccggccactggtgactgatcccacctcgaaggacaccaagtcaatctgccgtaatcat
cttgtggcggtgaccaaaagtggcctggtgaccattgcaggtggtaaatggactacttat
cgcttaatggctgaggacgcattaaacgccgctattaaaacccatggacttaatccaact
gcatcctgtcagacggttgggcttttactggaaggggccgttggctggactcctactctg
tacattcgattagtgcaggattatggtttaagcactgaggtttctcggcatctctccaac
acatttggtaccaaagctttcgaagttgccaaattggctaaggtcactggaaagagatgg
cccattgttggcaagcgactagtggctgaattcccatacatcgaagcagaggtgacgtat
gccgtgaaagaatacgcctgcacagctattgatgtgattgccaggcgcactcgcctggcg
ttccagaatatacaagcagcagaagaagctttgccacgtattgtagagataatggctgca
gaattgaactggaacgagcagaaaaaacaggaggaattggtgtccgctctgcgctttctg
tacttagaaatgggctacaaagtacgggatgaacagttgaccaaaaccacagaagtaaac
cttacccctgaagagttggacaggtttacgataaggttcaggaaattcgataaccaacag
aggggttttatcacttttgttgacgtccagcgtgtgttagagacaattgatcatgatatt
gatgaaaacgctctgcacgaaattgtaaatgaagttgacttaaacaagaacgggcaggtg
gaactacacgagttcttgcagttaatgagtgcagtgaaaaaaggctcggtgtcgagcagc
agattggcgatattgttgaaaagggccgaggagaaactggatcacagagaagctattcct
gtacaccggagtggcggaggtgtgtga

DBGET integrated database retrieval system