KEGG   Callorhinchus milii (elephant shark): 103176432Help
Entry
103176432         CDS       T03088                                 

Gene name
gad1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00250  Alanine, aspartate and glutamate metabolism
cmk00410  beta-Alanine metabolism
cmk00430  Taurine and hypotaurine metabolism
cmk00650  Butanoate metabolism
cmk01100  Metabolic pathways
Module
cmk_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103176432 (gad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103176432 (gad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103176432 (gad1)
   00430 Taurine and hypotaurine metabolism
    103176432 (gad1)
Enzymes [BR:cmk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103176432 (gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS OKR_DC_1 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 103176432
NCBI-ProteinID: XP_007888154
LinkDB All DBs
Position
Un
AA seq 591 aa AA seqDB search
MASNVPSSSGASQDSNPTNLRPGDRNTTYDTWCGVAHGCTKKIGLKICGFLQRTNSIEDK
SRIGGALKSPKNLITCDNSDRDLRFSRNETDFSNLYARDLLPAKNGEEQTTQFLLEVVDI
LLNYVRKTFDRSTKVLDFHHPHQLLEGIEGFNLELSDQPESLEQILVDCRDTLKYGVRTG
HPRFFNQLSSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREMIGWQNGD
GDGIFSPGGAISNMYGIMAARYKYFPDVKVKGMSAAPKLILFTSEHSHYSIKKAGAALGF
GTDNVILLKCDKRGKVMPSDLEAKIIEAKQKGYVPLYVNATAGTTVYGVFDPIQEIADIC
DKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVREKGL
LQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEIQINKC
LDLSMYLYTKIKNREGYKMVFDGEPEHTNVCFWFIPPSLRGMPDCADQMEKLHKVAPKLK
ARMMECGTTMVGYQPQGDKTNFFRMVVSNPAATMSDIDFLIDEIERLGQDL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaatgttccttcatcctctggtgcgagtcaagactccaaccctacaaattta
cgaccaggagacaggaatacaacctatgacacctggtgcggtgtggctcacggctgcaca
aagaaaatcggtctgaaaatctgcggtttcttgcaaagaaccaacagcatcgaggacaag
agcagaattgggggggcgctgaagtcccccaagaacctgatcacctgtgacaacagcgac
agagacctcagattcagtcgcaacgagacggacttctccaatctctacgccagagacctg
ttgcctgccaagaatggagaagaacagacaacccaattccttctggaggtggtcgacatc
ctcctcaactacgtcaggaaaacgttcgacaggtccacaaaagtcctggatttccaccac
ccacaccaactcctggagggaatagagggcttcaacctggagctctcagaccaacctgag
tccctggagcagatactggtggactgcagggacaccctgaaatatggagtcagaacagga
catcctcgtttcttcaaccagctttcttctggtctggatatcatcggtttggctggagaa
tggctcacgtccacagctaataccaacatgttcacgtatgaaatcgcaccagtctttgtc
ctcatggaacagatcactctgaagaaaatgcgggagatgatcggctggcagaacggagat
ggcgatggaatcttttcacctggaggagctatttcaaatatgtatggtattatggcagct
cgctataagtatttcccagatgtcaaagttaaagggatgtctgcagcccccaaattgatt
ctgttcacttcagagcatagtcactactcaataaagaaagcaggagccgcacttggtttt
ggaacagataacgtgatcttgttaaaatgtgacaaaagagggaaagtaatgccatctgac
ctggaagcaaaaattattgaagctaagcaaaagggatacgttccactttatgttaatgca
actgcaggaactacagtatatggcgtgtttgatcctattcaggaaatagcagatatatgt
gataaatataacctctggctccatgtcgatgctgcatggggaggcggacttctgatgtct
agaaaacatcgccacaagttgaatggcattgaaagagccaactcagttacttggaatccc
cacaagatgatgggagttttgttgcagtgctcagctatccttgttcgagaaaaggggctc
cttcaaggctgcaaccagatgtgtgcagggtacttgttccagcctgacaagcagtatgat
gtatcttacgacacaggagataaagcaattcagtgtggtcgtcatgtggatattttcaag
ttttggttgatgtggaaagctaagggcacagtgggatttgagattcaaattaacaagtgc
ttggatctgtcaatgtacctctacaccaagattaaaaacagggaaggctacaaaatggta
tttgatggagaacctgagcacacaaacgtttgtttttggttcattccaccaagtctccga
ggaatgccagattgcgcagatcaaatggaaaaacttcacaaggtggctccaaaattaaag
gcacgaatgatggaatgcggcactacaatggttgggtatcaaccgcaaggcgacaaaact
aacttcttccgtatggtggtgtcaaacccagccgcaacaatgtccgacatcgacttcctc
atcgatgagattgaaagactgggacaggatttgtaa

DBGET integrated database retrieval system