KEGG   Callorhinchus milii (elephant shark): 103176732
Entry
103176732         CDS       T03088                                 

Gene name
rassf1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
cmk  Callorhinchus milii (elephant shark)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 103176732
NCBI-ProteinID: XP_007888661
UniProt: A0A4W3K0B0
LinkDB
Position
Un
AA seq 376 aa
MAELIELRDLKDRSPMEATLSRTSRSPGLERTNAMRITPGGRGADILSRVRAGRPPARSR
LLLTGLGDQDPRLTERPGEGHDFNPCTQTQPSWCDLCGEFIWGIYKQSLQCTNCKFRCHY
RCQPLIKLDCNRPKTKTSENVDITELVLEQDTNVDECIDWEKQILSRDEIERKIRDYNAQ
IANNLLMTLNSDGTYTGFIKVQLKLVRPISVSANTKPQSIYDTKKTGATRSQPVKRRTSF
YLPKDTVKHLHISSVTRASEVIEALLNKFLVVDNPRKFALFERIEKEDQVYTRKLSDEEH
PLYLRLLAGPDDKMLSLVLRENETGEVNWDAFTPPELQNFLRILKREEDAHIKQVFERYT
RCRERLQEELSSRTPG
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcggaactgattgaactgcgggacctgaaagaccgcagcccgatggaagcgaccctc
agcaggacctcgcgctccccgggtttggagaggactaacgccatgcgcatcacccccggg
ggcagaggcgcagacatcctgagccgggtcagggccggccggccaccggcgaggagccgg
ctgttgctgacggggttgggggaccaggaccccaggctgaccgagagaccaggcgaggga
cacgacttcaacccgtgcacccagactcagcccagctggtgcgatctgtgcggggagttc
atctgggggatctacaagcagagcctccagtgcacgaactgtaagttccggtgtcactat
cgttgccagcctctgatcaaactggactgtaatcgccctaagaccaagacatcggagaat
gtggacatcacagagctggtgctggagcaagacaccaatgtggatgagtgcattgactgg
gagaagcagatcctctcgcgagacgaaattgaacgcaagatccgggactacaacgcacag
atcgccaataacctcttaatgaccttgaacagcgacggaacctacaccggattcatcaaa
gtgcagctgaagctggtgcgcccgatctcagtgtctgccaacaccaagccccagtccatc
tacgacaccaagaagacgggggctacgcgctctcagccggtcaaacgccgcacgtccttc
tacctcccgaaggacacagtgaagcaccttcacatcagcagcgtcacccgggccagtgag
gtgattgaggccctgctcaacaagttcctggtggtcgacaatccgcgcaaattcgctctc
ttcgaacgcatcgagaaagaagaccaagtgtacacccgtaagctgtcggatgaggaacac
cccttgtacctgcgtctcctggctggtcctgacgacaagatgctgagccttgtcctgagg
gagaacgagacgggagaagtgaattgggatgccttcacccctcccgagctgcagaacttc
ctacggatcctaaagcgcgaagaggacgcgcacattaagcaggtgtttgagaggtacact
cgctgtcgggagcggctacaggaagagctgtccagcaggacccctggttga

DBGET integrated database retrieval system