KEGG   Callorhinchus milii (elephant shark): 103177112Help
Entry
103177112         CDS       T03088                                 

Gene name
hdac8
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmk03036]
    103177112 (hdac8)
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103177112 (hdac8)
Chromosome and associated proteins [BR:cmk03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     103177112 (hdac8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103177112
NCBI-ProteinID: XP_007889284
LinkDB All DBs
Position
Un
AA seq 338 aa AA seqDB search
MVHSLIASYGLLKYMRLVKPRVASMAEMAMFHTDAYLEHLRKISEDGDDDNPESLEYGLG
YDCPAIEGVFDFAAAVAGASLTAAQCLIDKTCQVAINWPGGWHHAKKDEASGFCYLNDAV
LGILKLREKFDRVLYVDLDLHHGDGVEDAFSFTSKVMTVSLHKYSPGFFPGTGDVNDVGM
GKGRYYTVNVPLQDGTPDTRYCQICQSVLKEVYASFHPEAVVCQLGADTIAGDPMCSFNM
TPVGVAKCLRYILNWQLPTLVLGGGGYNHANTARCWTYLTAIILGKILPSEIPDHEYFID
YGPDYVLEITPSCRTDQNDSQRIEQLLSTIQGNLKNVI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggtgcattctctgattgcctcttacggattgctgaagtacatgaggctggtgaaaccc
cgagtggcttccatggcggagatggccatgtttcacacggacgcttacctggaacatctg
cggaaaatcagtgaagacggcgatgatgacaatcccgaatccttggagtacggactgggc
tatgactgtcctgctatcgagggagtgtttgactttgctgctgcagtagccggggcctct
ctcactgccgctcagtgcctgattgataaaacctgccaagttgccataaactggcctgga
ggctggcatcacgcaaagaaggacgaagcctctggcttctgctacttgaacgacgctgtc
ctgggcatcttgaagctccgcgagaagtttgaccgagttctgtacgtggatctggacctg
caccatggcgatggcgtggaagatgcattcagtttcacatctaaagtaatgaccgtgtct
cttcacaagtactcccctggattcttcccaggcacgggcgatgtgaatgacgtgggaatg
gggaaagggaggtactacaccgtgaatgtcccactgcaagatggcactccagacacccgc
tactgccaaatctgtcaaagtgtgttgaaagaggtgtacgcgtccttccaccccgaggct
gtggtctgccagttgggagcagacaccatcgctggagaccccatgtgttcctttaacatg
acgccagtcggagtggccaagtgcttacgttacatcctgaactggcagctgccaactctg
gttcttggaggagggggctataaccatgccaacacggcgcgctgctggacatacctgact
gctattatcctcggaaaaatactaccctcagagattcccgatcacgagtattttatagac
tatgggccagattacgtgctggaaatcacccccagctgcaggaccgatcagaacgattcc
caacgcatcgaacagttacttagcacgattcaaggaaatctgaagaatgtaatttaa

DBGET integrated database retrieval system