KEGG   Callorhinchus milii (elephant shark): 103179079
Entry
103179079         CDS       T03088                                 

Gene name
cdkn1a
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04012  ErbB signaling pathway
cmk04068  FoxO signaling pathway
cmk04110  Cell cycle
cmk04115  p53 signaling pathway
cmk04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103179079 (cdkn1a)
   04068 FoxO signaling pathway
    103179079 (cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103179079 (cdkn1a)
   04115 p53 signaling pathway
    103179079 (cdkn1a)
   04218 Cellular senescence
    103179079 (cdkn1a)
SSDB
Motif
Pfam: CDI DUF4667
Other DBs
NCBI-GeneID: 103179079
NCBI-ProteinID: XP_007892354
LinkDB
Position
Un
AA seq 155 aa
MKPRRVCRNLFGAVDRGELRKELQREMQNSLEEASIKWNFDFGAERPLAGALQWEAVRSQ
ELPLFYRSFVVGGSTGQHVTGLRSMGKENAASQREGETSGEHRTEKAVKCPGTLHTAQHQ
ANGSCPCSHKRRQSVITDYYIVKRKSVRSVCKPQP
NT seq 468 nt   +upstreamnt  +downstreamnt
atgaagcccaggagggtttgccggaacctctttggggctgtggatcgaggagagctgagg
aaagagctgcagcgggagatgcagaacagcctggaggaagccagcattaaatggaacttt
gatttcggagcggagaggcctttggccggagcactgcagtgggaggcagtgagaagccag
gagttgccgttattctacagatccttcgttgtcggaggcagcacgggacagcatgtgact
gggctacgttctatgggcaaggagaacgcagcttcccaaagagagggtgagacctctggg
gaacacaggaccgagaaggctgtaaaatgtcccggcactttgcacactgcccagcaccaa
gcgaatggcagctgcccatgctcacacaagaggaggcagagtgttataacagattactac
attgtgaagaggaagtctgtgcggtcagtatgtaagccgcagccgtaa

DBGET integrated database retrieval system