KEGG   Callorhinchus milii (elephant shark): 103179335
Entry
103179335         CDS       T03088                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04012  ErbB signaling pathway
cmk04068  FoxO signaling pathway
cmk04110  Cell cycle
cmk04115  p53 signaling pathway
cmk04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103179335
   04068 FoxO signaling pathway
    103179335
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103179335
   04115 p53 signaling pathway
    103179335
   04218 Cellular senescence
    103179335
SSDB
Motif
Pfam: CDI DUF2742
Other DBs
NCBI-GeneID: 103179335
NCBI-ProteinID: XP_007892744
UniProt: A0A4W3IIH6
LinkDB
Position
Un
AA seq 152 aa
MMGLESEEKVEIDPKVKADRVRRNLFGPVDHEQLQEDFQRLLWTSIEVARQKWNFDFIRE
IPSAGTLEWEELSCQDVPAFYRSCVIRGRKHLQGLQGATLQNSSCSQQPEVQAQERKTQG
TPQPKKRRQTCMTDYYSAKRRCTSETDYSSKE
NT seq 459 nt   +upstreamnt  +downstreamnt
atgatgggactcgagtctgaagagaaagtggaaatagacccgaaggtcaaggcggaccgt
gtccgaagaaacttattcggtcccgtcgatcacgagcaactgcaggaggactttcagcga
ttactgtggacaagtattgaagttgccaggcaaaaatggaactttgatttcataagggaa
atcccatcagcggggactctcgaatgggaagagctgagttgccaagatgtcccggctttt
tacaggagctgcgttatccgtggaaggaaacatttacaaggactgcagggggcaacgctg
cagaacagcagctgctcacaacagccagaggttcaagcccaggaaaggaaaacccagggg
acacctcagccaaagaaaaggagacagacctgcatgacagattactattctgctaaaagg
aggtgcacaagcgaaaccgattacagcagcaaagagtag

DBGET integrated database retrieval system