KEGG   Callorhinchus milii (elephant shark): 103179336
Entry
103179336         CDS       T03088                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04012  ErbB signaling pathway
cmk04068  FoxO signaling pathway
cmk04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103179336 (cdkn1b)
   04068 FoxO signaling pathway
    103179336 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103179336 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103179336
NCBI-ProteinID: XP_007892745
UniProt: V9KVY0
LinkDB
Position
Un
AA seq 203 aa
MSNVRISNGSPTLERMAAQQPGHPKPSACRSLFGPVDHDELSRDLQKKRNESHEQDRLRW
NFDFERDKPLDGNYKWEAVDFKDVPDFYWRQTRERVSPADCGVDVNGNRAIVYIGTTVAQ
GNAAGDTYFANSERSDAVKETAERCTDSKEQCSAPRKRTASVDCSPEAKRVTTKAESEWS
ANSPSLSAFEQTPKKSIPSGHHT
NT seq 612 nt   +upstreamnt  +downstreamnt
atgtcaaacgtacgcatttccaatggtagcccaacgctggagagaatggcagcccaacaa
cccgggcacccgaagccctccgcttgcaggagcctcttcggccccgtggaccacgacgag
ctgagccgcgacctgcagaagaaacgcaacgagagccacgagcaggaccgcctgaggtgg
aattttgacttcgagagggacaaaccgttggatgggaattacaaatgggaagccgtggat
ttcaaggatgtgccggatttttactggcgtcagacccgggagcgagtgtcgccggcggat
tgcggtgtggatgtgaacgggaaccgtgcgatagtttacattggcacaactgtggctcag
ggaaacgcggcgggggatacgtactttgcgaactcggagcggagcgacgcggttaaagag
acagccgagcgctgtacggactcaaaggagcagtgctccgctccccgcaagcgaactgcg
tcagtcgattgctctccagaagcgaaaagggtcaccacgaaggcagagtccgagtggtca
gcgaattctcccagtctgagtgctttcgagcaaacgccgaaaaaatcgattccgagtgga
catcacacataa

DBGET integrated database retrieval system