KEGG   Callorhinchus milii (elephant shark): 103179419
Entry
103179419         CDS       T03088                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04010  MAPK signaling pathway
cmk04020  Calcium signaling pathway
cmk04260  Cardiac muscle contraction
cmk04261  Adrenergic signaling in cardiomyocytes
cmk04270  Vascular smooth muscle contraction
cmk04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103179419
   04020 Calcium signaling pathway
    103179419
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103179419
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103179419
   04261 Adrenergic signaling in cardiomyocytes
    103179419
   04270 Vascular smooth muscle contraction
    103179419
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cmk04040]
    103179419
Ion channels [BR:cmk04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103179419
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel RibD_C DUF4834
Other DBs
NCBI-GeneID: 103179419
NCBI-ProteinID: XP_007892902
LinkDB
Position
Un
AA seq 2202 aa
MGSARDGCRFLWCVCVCVCVFFSLQCKCKRVAVRVFDFRGVWWVGGVWCLLSGANYGSSR
PALDHGHSNANTDGLAPEHIPGPGAALSWQAAIDAARQAKAAAMLGGNTVSTANSTQRKR
QPYSKQKKQANAATTRPPRALFCLTLKNPIRRACINIVEWKPFEIIILLTIFANCVALAV
YIPFPEDDSNATNSNLERVEYLFLIVFTVEAFLKVIAYGLILHSNAYLRNGWNLLDFIIV
VVGLFSAILEQATKAEGTNPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIK
AMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYVNGTDTIGEEESAPCNGNVGHGRQ
CPNETLCKNGWVGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGFELPWVYF
VSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAE
DIDPENEDEGMEEEKPRNMSMPTSETESVNTENVGAAEIEDLTCCASLGHRISKSKFSRY
WRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTISSEHYSQPNWLTEVQDTANKVLLA
LFTGEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLL
RIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMETK
RSTFDNFPQSLLTVFQILTGEDWNSVMYDGIRAYGGPSFPGMLVCIYFIILFICGNYILL
NVFLAIAVDNLADAESLTSAQKEEEEEKERRKLARTSSPEKTTENEKPPIEEEKKEEKIE
LKTITVDGDMPPSTKIGLDEYQVEENEEKNPYPTNEFPGEEEEDEPEMPVGPRPRPLSDL
QMKEKAVPMPDASAFFVFSTTNRFRVLCHRIVNDNIFTNLILFFILLSSISLAAEDPVHQ
YTRRNQILTYADYVFTSIFTVEIILKMTAYGAFIHKGSFCRNYFNILDLVVVSVSLISFG
MQSSAIAVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVALRTIGNIVIVTTLLQFMFAC
IGVQLFKGKLYSCTDGSKQKESECKGQYILYKDGNVNQPIISHRKWENSEFNFDDVPSAM
MALFTVSTFEGWPQLLYRAIDSHTEDTGPIYNYRVEISIFFIIYIIVIAFFMMNIFVGFV
IVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLM
FVLILLNTICLAMQHQGQAQRFSHAMDVLNMLFTGLFTVEMILKLIAFKPRGYFSDPWNV
FDFLIVIGSIIDVILSEINHYFCDAWNTFDALIVVGSVVDIAITEVNVSNHSFCSPYMNS
DENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVI
GMQVFGKIAMIDNSHINRNNNFQTFPQAVLLLFRCATGEAWQEIMLSCLPGKQCEKESAS
QEAEFICGTHFAFFYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRI
WAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNA
TLFALVRTALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYA
TFLIQDYFRKFKKRKEQGIVGKAVQKNSLSLQAGLRTLHDIGPEIRRAISGDLTAEEELE
KAMKEAASVASEDDIFRRAGGLFGNHVSYYPGDGRLSFPQTFTTQRPLHLNKSGSSQAEI
DSPSHEKLVDSTFTPSSYSSSGSNANINNANNTALSRLSSPVNFQSTVNTVDGPGSSLTC
ALLLQGTAWKLDPESSDSGESHLPIIQRVEASPDETYDENFNEGPDCCSEESMLSSQLIC
YQDEEDNKQLTPSVDFCEESEKKWQSSPKGLLSVTSLGRRSSFHLECLKRQKNHGLAISR
TASLSQRTALPLHLIQHQALAVAGLSPLLRRSHSPTQFSRLTTTPPSTPCSRGRLQQHIP
TLFLDGIQSYEKLNSSLPSVNSNSWYSDNSNGNIKKVRPVSLTVPYPFREKGNECHSSAG
SLVEAVLISEGLGRYAQDPKFVEAAAHEIADACDMTFEEMENAADNLLSGNKKASPNGNL
LPYVNCRDNQPQDPVPDSAEEEQDCEKSEEEFADEMIYVSTL
NT seq 6609 nt   +upstreamnt  +downstreamnt
atgggctcagcgagggatggctgtcggtttctctggtgtgtgtgtgtgtgtgtgtgtgtg
tttttctcgttgcaatgcaaatgcaaacgtgttgcggtgcgtgtttttgatttccggggt
gtgtggtgggtggggggggtttggtgtttgctttcaggcgcaaactacggcagcagtcgg
ccagcacttgaccatggacactccaacgccaacacggacggtttggcaccggagcacatc
cccggaccgggggctgccctgtcctggcaggcagccatcgacgcggccagacaagccaag
gctgccgcgatgctggggggcaacacggtctccaccgccaactccacccaaaggaagagg
caaccgtacagcaaacagaagaaacaagccaacgccgccaccacacgaccgccgcgggct
ctcttctgcctgactctcaaaaaccccatcaggagagcgtgcattaacatagtcgagtgg
aagccattcgaaataatcattctcctcaccattttcgccaattgcgtggccttagctgtc
tacataccttttccagaagatgactcgaatgcaaccaattccaatctggaacgagtggaa
tatctctttctgatcgtttttaccgtggaagcatttttgaaagtaatagcttatggactt
atccttcactctaatgcttacctcaggaatggctggaatttgctagatttcatcatagtg
gttgtagggctttttagtgctattttagaacaagcaaccaaagcagaggggactaaccca
attggagggaaagctgctggttttgatgtgaaagctctgagagcatttagagtcctgaga
ccattacgtctggtatctggagttcccagcctccaagttgtgttaaattcaatcatcaag
gccatggtaccattgctgcacattgctttattggtactttttgtaattatcatctacgct
attataggattagaactcttcatgggcaaaatgcacaaaacctgctacgtaaatggaaca
gacacaattggtgaagaagagtctgctccatgcaacggaaacgtgggacatggccgccag
tgtccaaatgaaacactctgtaagaatggatgggttggccccaatgatggaatcactaac
ttcgacaactttgcctttgctatgctaactgtatttcagtgcatcaccatggagggatgg
acagatgtattatattggatgcaggatgccatgggctttgagttaccctgggtctatttt
gtgagtctggtcatctttggatcctttttcgttctaaatctggttcttggtgtattaagc
ggagagttttccaaagagagagagaaggccaaggctcgtggtgattttcagaaactaaga
gagaaacaacaattagaggaggatctaaagggatacttggactggattactcaagctgaa
gacatagatccagaaaatgaagatgagggaatggaagaagagaaacccagaaacatgagc
atgcccactagcgaaactgagtctgtgaacactgagaatgtgggtgctgcagaaatagaa
gacttgacctgctgtgcaagtcttgggcaccggatatccaagtccaaattcagtcgatat
tggcgcagatggaaccgattttgtaggagaaagtgtcgcgctgctgtgaaatccaatgtg
ttctattggcttgtgatatttctggttttcctcaacacccttacaatttcatctgaacac
tatagccagcctaactggctgactgaagttcaagatactgcaaacaaagtcctcctggca
ctttttactggtgaaatgctgcttaagatgtacagtcttggcctgcaagcctactttgta
tctcttttcaaccgctttgactgtttcattgtctgtggaggaatccttgaaactatttta
gtggagactaagatcatgtcccccctaggcatttcggtgcttcgttgtgtgcggcttcta
aggatatttaagattacaaggtactggaattctttgagtaacctggtagcatcccttttg
aactcagtccgatccattgcttcattattgctgcttctgttccttttcatcatcattttt
tctctgttgggtatgcaactatttggaggaaagttcaactttgatgagatggaaaccaaa
aggagtacatttgataactttcctcagtcccttctcacggtcttccagatcctgacaggt
gaggactggaattcagtcatgtatgatgggataagagcatacggagggccatctttccca
ggaatgttggtctgcatttacttcatcatcctcttcatttgtgggaactatattctatta
aatgtgttcttggccattgctgtggacaatttggctgatgccgagagtttgacttctgcc
caaaaggaagaagaggaagaaaaggaacgcagaaagcttgccaggacttcaagtccggag
aaaactacagagaatgaaaagccaccaatagaggaagagaagaaggaagaaaaaattgaa
ctaaaaacgatcacggtagatggagacatgccaccatctacaaagattggattggatgaa
taccaggttgaagagaatgaggagaagaatccctatcctaccaatgagttcccaggtgaa
gaagaagaggatgagccagaaatgcctgtaggaccacgtccccgtccgctttctgatctg
cagatgaaagagaaagcagttcctatgcctgatgcgagtgcattctttgtgttcagtaca
acaaacaggtttcgtgtgctgtgtcacaggatcgtcaatgacaacatttttacaaatctt
atcttattcttcatcctcttgagtagtatttcattggcagcagaggatcccgtccatcag
tatacgcgcagaaaccaaatccttacctatgcagattatgtcttcactagtatctttaca
gtagaaatcatactaaagatgactgcttatggggctttcattcataaaggctccttctgc
agaaattatttcaacatactggacttggtggtggttagcgtctctctcatctcctttgga
atgcagtccagcgcaattgcagtagtaaagattctccgagttttgcgagtgttgagacct
ttgagagccatcaacagagccaaggggttgaagcacgttgttcagtgtgtgtttgtggcc
ctgaggaccattggtaacattgtgatagtgaccactttactgcaattcatgtttgcttgt
attggagttcagctcttcaaggggaaactctattcctgcacagatggatccaagcaaaag
gaatctgaatgcaaaggtcaatatattctgtacaaagatggaaatgtaaaccaaccaata
ataagtcaccgtaaatgggagaacagtgaattcaactttgatgatgtcccctctgctatg
atggctcttttcactgtttctacctttgaaggctggccacagttgctgtatcgagccatt
gactctcacacagaggacactggtccaatttacaactaccgtgtggagatatctattttc
ttcatcatctacatcattgttattgccttcttcatgatgaatatcttcgtaggtttcgtc
attgtcacattccaggaacagggagaacaagagtacaaaaactgtgagctggacaaaaat
cagcgccaatgtgtggagtacgccctaaaggctcggcctctgcgacggtacatcccaaag
aacccttaccagtacaaagtctggtatgtggtgaactcaacctactttgagtacctgatg
tttgttctgatcttgctgaacaccatctgcttggctatgcagcatcaaggtcaggcccaa
cgcttcagtcatgcaatggatgtcctcaatatgctcttcactggacttttcacggttgaa
atgatcctgaaattaatcgcgttcaagcccagaggttactttagtgatccctggaatgtt
tttgacttcctcatcgtaattggcagcattatagacgtcattctgagtgagatcaatcac
tatttttgtgatgcatggaatacatttgacgccttaattgttgttggtagcgttgttgat
atagctatcacagaggtgaacgtaagtaaccacagtttttgcagtccttatatgaattca
gacgaaaactctcgcatttccatcaccttcttccgtctttttcgggtgatgcgtttggtc
aaattgctgagtcgaggtgagggaatacgaactctgctgtggacatttatcaaatcattt
caggcacttccatatgtcgctcttctgattgttatgctgtttttcatctatgctgtgatt
ggaatgcaagtgtttggtaaaattgccatgattgataatagtcacatcaacaggaacaac
aacttccaaacctttccacaggctgttctgctgctcttcagatgtgctacaggtgaagcc
tggcaagaaattatgctatcctgcctcccaggaaaacagtgtgagaaagaatcagcaagt
caggaggcggaattcatctgtgggactcactttgctttcttctactttgttagcttctac
atgctgtgtgcctttttgatcattaacctctttgtggctgtaatcatggataattttgac
tatttaacacgtgattggtccattctgggtcctcatcatcttgatgaatttaagagaatc
tgggccgagtatgatcctgaggcaaagggacgtatcaagcacttagacgtggttacactg
ctaagaagaatacagcctcctttaggatttggcaagctgtgcccacatcgtgttgcctgc
aaacgcttggtatctatgaacatgcctttaaacagcgatggcacagtcatgtttaatgca
actctctttgctttggttcggactgcactgagaattaaaactgaaggaaacttggagcaa
gcgaatgaggagctgcgagcaattgtcaagaaaatctggaaacgcacaagtatgaagctg
ctggatcaggttgtaccaccagcaggagatgatgaagttactgtgggcaagttctatgcc
acgttcctaatccaggattacttcagaaagttcaagaagcgcaaagaacagggcatagtt
ggaaaagcagtgcagaaaaattcactttctttgcaggctggtctgcgtactttacatgat
attggccctgagattcggcgtgccatatctggagacctcacagcagaggaagaactggaa
aaggcaatgaaggaagctgcttcagtggcatctgaagatgatatcttcaggagggctggt
ggtctgtttggtaatcatgtcagctattatccaggtgatgggaggctctctttcccacag
acattcaccacccagcgccctttgcacctcaataaatcgggaagctcccaagcagaaatt
gactcaccttctcatgagaagctggttgattctacgtttactccaagcagctattcctct
tctggatcaaacgccaacatcaacaatgctaataacactgccttgtccagattatcgagc
ccagtcaacttccaaagcactgtgaacacagtggatggtcccgggagttcactgacttgc
gcacttttattacaaggaacagcgtggaaacttgatcccgaaagctcagactccggagaa
agtcacttgccaattatccaacgggtggaagcatctccggatgaaacttacgatgaaaat
tttaatgaaggtcctgattgctgcagtgaagaaagcatgctttcttcacaactgatttgt
tatcaggatgaggaggataacaaacagcttactccatcagtagacttttgtgaagaaagt
gaaaaaaaatggcagtcttctccgaaagggcttctttcagtaacatcgttaggaagaaga
tcatcatttcacctggagtgcctgaagagacagaagaatcacgggttagcaatctctcgg
acagcgtcactctctcagaggacagcactaccactgcacttaatccagcaccaggcgtta
gctgttgctggtctgagcccgctgctcaggagaagccattctccaacacaattttccaga
ttgaccaccacacctccttctactccatgcagtagagggaggttgcagcaacacatccca
accctattcctggatggcattcaatcctacgagaaactaaacagcagccttccgtcagta
aattctaattcctggtactctgacaactcaaatggaaatatcaaaaaggtcaggccagtt
tctctgaccgtaccctatcctttcagggaaaagggcaatgagtgtcatagcagtgctggt
agtctggtagaggcggttctgatctcagaggggcttggtcgatatgcacaagacccaaaa
tttgttgaggcagcagcacatgaaattgctgatgcctgcgacatgacgttcgaagagatg
gagaacgcagcagacaacttgttgagtggcaataagaaagctagcccaaatggcaatctg
ttaccatatgtgaactgtagagacaaccagccacaggaccctgtgccagatagcgcagaa
gaggagcaggactgtgagaaaagcgaggaggaatttgcagatgagatgatttatgtaagc
accctgtag

DBGET integrated database retrieval system