KEGG   Callorhinchus milii (elephant shark): 103179983Help
Entry
103179983         CDS       T03088                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00590  Arachidonic acid metabolism
cmk01100  Metabolic pathways
cmk04370  VEGF signaling pathway
cmk04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103179983 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103179983 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103179983 (ptgs2)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103179983 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 103179983
NCBI-ProteinID: XP_007893749
LinkDB All DBs
Position
Un
AA seq 655 aa AA seqDB search
MLNCIKQGLWEPAEAEAELKWIAVQVTEKFFHKSKETKADADSRRSTMYLAASLFLAALL
SVNQAANPCCSHPCQNQGVCTTVGFDGYECDCTRTGFYGENCTNPEFWTWVKLSLKPSPN
TVHYILTHYSGLWNFINSISFLRDAIMRYVLTSRSHLIDSPPTYNAKYGYKSWEAYANIS
YFTRTLPPIPEDCPTPMGVVGKKVLPDPKYLAERFLMRKKFIPDPQKTNMMFAFFAQHFT
HQFFKTDQSRGAAFTKGLGHGVDLSHVYGETLVEQYKLRLFKDGKLKYQVINGDVYPPIV
KEAPVDMTYPPHVPEHLRFAVGQEFFGLVPGLMMYATIWLREHNRVCDILKVEHPDWEDE
QLFQTSRLILIGETIKIVIEDYVQHLSGYNFKLKFDPELLFNQHFQYSNRIASEFNMLYH
WHPLMPDTFDIQNKAYSYREFLFNNTVLLEHGISNMVSSFSKQIAGRVAGGRNMNPALLN
VAIANIKHSRELRYQSMNEYRKRFLMKPYVSFEDLTGEKEMAAELRELYGDIDAMELYPG
LMIEKPRPGAIFGETMVEMGAPFSLKGLMGNPICSPQYWKPSTFGGNVGFDIVNTFSLQK
LICNNVKGPCPFVTFSVPESTASNSGSPSSDSSNTGLEDVNPQGHVLLKERSVEL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgctgaactgcataaagcaggggctttgggaaccagcagaggcagaagctgagttgaag
tggatcgcagtgcaagtcacagagaagttcttccacaagtcgaaagaaacaaaagcagac
gcagattccagacgctcaaccatgtatttagcagcctctctcttcctggctgctctactc
tcagtgaatcaagcagcgaatccttgctgctctcatccctgccagaaccaaggggtctgc
accacggtgggcttcgatggctatgaatgcgattgcacacggaccggattttacggcgag
aactgcaccaatcctgaattctggacttgggtgaaattgtccttgaagccttctcccaac
actgtgcattacatcctcacccactattctggattgtggaactttataaacagcatatct
ttcctgagggacgccatcatgcgttatgtgctaacgtcccgatctcatttgatcgacagt
ccacctacctacaacgcaaaatatggttacaaaagctgggaagcttatgccaatatcagc
tacttcaccagaaccctgcccccaatccccgaagactgcccgactccaatgggagtagtt
ggaaagaaagttctgcccgatcccaagtatttagcggagcggttccttatgaggaagaag
ttcatccctgatcctcagaagaccaacatgatgtttgccttcttcgcacagcatttcacc
catcagttttttaagacagaccagagccgaggagcagccttcactaaagggttaggtcat
ggggttgacctaagtcatgtgtacggagaaacgttagtcgaacaatacaagctgagactg
tttaaagacgggaaactcaagtaccaggttatcaatggagacgtttatcctcccatcgta
aaggaagcccccgtagacatgacctaccctcctcatgtgccggagcacttgcgctttgct
gtgggccaggaattctttggtctggttccaggcctgatgatgtacgcaacgatctggctg
cgggagcacaaccgagtgtgtgacatcttgaaagtcgagcaccccgactgggaggatgag
cagctcttccagaccagccgactcatcctgataggagagaccatcaaaatagtcattgaa
gattatgtgcagcatctgagtggctataacttcaagctgaaatttgatcccgagcttctc
tttaaccaacacttccaatacagcaaccgcattgcctcagagttcaacatgctctaccac
tggcaccccctgatgccggacacctttgatattcagaataaggcatacagctaccgggaa
ttcctctttaacaacacagttctgctggaacacggcatctccaatatggtttcttcgttc
tccaagcagattgctggaagggttgctggcggcaggaacatgaatccagcattgctcaat
gtggccatcgcaaacatcaaacacagccgcgagcttcgctaccagtctatgaacgaatac
aggaagcgctttttaatgaagccttacgtgtcttttgaagacctcacaggtgagaaagaa
atggcagctgagctgagggaactgtatggagatattgatgcaatggagttgtaccctggt
ctgatgatagagaaaccaagacctggagccatttttggagaaaccatggtcgagatgggc
gcccctttctctttgaagggtttaatgggaaaccctatctgctcgcctcaatactggaaa
cccagcacttttggtgggaatgtcggctttgacatcgtgaacaccttttcactgcagaag
ctgatctgcaacaatgtgaagggtccttgcccattcgtcacattcagcgttcctgaatct
acagccagcaattcaggttctcccagctccgattcgtccaacacaggtctggaagatgtt
aatccacagggtcatgtactgctgaaagaacgatcagtggaactttaa

DBGET integrated database retrieval system