KEGG   Callorhinchus milii (elephant shark): 103180325Help
Entry
103180325         CDS       T03088                                 

Gene name
tmprss4
Definition
(RefSeq) transmembrane protease, serine 4
  KO
K09635  transmembrane protease serine 4 [EC:3.4.21.-]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cmk01002]
    103180325 (tmprss4)
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103180325 (tmprss4)
Peptidases [BR:cmk01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103180325 (tmprss4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR SRCR Trypsin_2 Ldl_recept_a DUF1986 Intg_mem_TP0381
Motif
Other DBs
NCBI-GeneID: 103180325
NCBI-ProteinID: XP_007894305
LinkDB All DBs
Position
Un
AA seq 460 aa AA seqDB search
MPRKLNEQKLHGSVSEQDSTEYCTYDPPNSAIPLNPGFLPESMNRMKMTKRKIVITTLLV
LTVLAIIGISIYFVKVLLDTNYFFCVKSFKFISLEAQCNGVSDCMDSEDEMNCVINITFT
GEFPVRISGADSILEVYNSESRTWRPVCYKDWDEKLAQATCKQLGHSRHQELVSRPVPML
SVSVFAMIDISKDYAQKSIQSILRDGSCSDKKVVSLVCEQCVRSGEERIVGGNDAYIDNW
PWQVSLKYKDQHLCGGSILNSQWIVTASHCFSKEHDQIQLWEVYVGTEYLKSGGRTFRVG
KIITNGQFDDNDNDYDIALIKLKSALPYTEYIRPICLPNYNTPISPNQEAWITGWGHTKQ
SGKGSDVLQKASVLVIDRITCNQREVYAGQITPRMLCAGFLEGKVDACQGDSGGPLSYHS
DMWRLLGVVSWGRGCAIPNRPGVYANISFFLDWIYHVMQS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggaaactgaacgaacagaaactgcacggcagtgtatcggaacaggactccact
gaatattgtacctacgatcctccaaattcagccatcccgctgaatccagggtttctgccc
gagagcatgaacaggatgaagatgacgaagaggaagatagtgattacgacgctcttggtc
ctgacggtgctggccatcatcggtatctccatctacttcgtgaaggtactcctcgacacc
aactactttttctgcgtcaagtccttcaagttcatctctctggaggcgcagtgcaatggg
gtctcggactgcatggacagcgaggacgagatgaactgcgtcatcaacatcaccttcacc
ggggaattcccagtgagaatttccggagcggactctatcttggaggtgtataactctgag
agccggacctggaggcccgtgtgctacaaggactgggatgagaaactggctcaagccact
tgcaaacaactgggacattccaggcaccaggagttggtcagccgtccggtgccaatgctg
tcggtctctgtcttcgctatgatcgacataagcaaagactacgcccagaagtcaatccag
tcgatactgagggacgggtcctgttctgacaagaaggtcgtatccctggtttgtgaacag
tgtgtcaggagtggggaggagcggattgtgggtggcaatgacgcgtacatcgataactgg
ccctggcaggtcagcctgaaatacaaggaccaacatctgtgcggaggaagcatcttaaac
tcccagtggattgtcacagccagtcactgcttctccaaggaacacgaccagatccagctg
tgggaggtctacgtcggaaccgaatatctcaagagcggcggacggaccttccgggtcggc
aaaataatcaccaacggacagttcgacgacaacgacaacgattatgacatcgctctgatc
aagctgaagtctgcgctgccttacacagaatacatccggccgatttgtttaccgaactac
aacacaccgattagccccaaccaggaggcatggattaccggctggggccacaccaagcaa
tccgggaaagggtcggatgtgctgcagaaagccagtgttttggtgattgaccggatcacg
tgtaaccagagggaggtgtatgctgggcagatcacaccccgcatgctctgcgctggcttc
ttggagggcaaggtggacgcctgtcagggagacagcggaggtccgttatcttaccacagt
gacatgtggcggctactgggggtggtaagctgggggaggggctgcgctatccctaaccgc
cctggggtctacgccaacatcagcttcttcctcgactggatctaccacgtcatgcagtcg
tag

DBGET integrated database retrieval system