KEGG   Callorhinchus milii (elephant shark): 103180330Help
Entry
103180330         CDS       T03088                                 

Definition
(RefSeq) transmembrane protease serine 13-like
  KO
K09643  transmembrane protease serine 13
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cmk01002]
    103180330
Peptidases [BR:cmk01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103180330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 Trypsin_2 SRCR Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 103180330
NCBI-ProteinID: XP_007894309
LinkDB All DBs
Position
Un
AA seq 499 aa AA seqDB search
MNSMPNVYPQTDFRENPPPYSAVQPGDLPSYTSIQNPPPPYTSSPPRSHYPTAPPTSGNP
PGEYQPYYIPVSVPVTSSTAVTHAAVRPCKHFSCSRKRRCMGWGSSTSLVFGLVAVGIWL
IYTYVDFSPSSEPQCPSEFVHCDGKSECSDRSDEFGCVRFKKTTNELEVFSWKTNSWLPV
CYSGWSNDLASTTCQQLGFTGYFQSSKISSNQISTLTVNSTAKPGSNIQTILSSGDQCAS
REVVGLKCIDCGKRVNPSERIVGGTAAELQKWPWQVSLHFGSSHVCGGTIIAHDWILTAA
HCFLGDTALEPSNWKVYAGIISQRFKYNGQLRDISQIITHKQYSRSTNDNDMALLKLSRP
LTFTDRVQPACLPAYNQQFPENSRCWTTGFGHLQDGASSISESLQQVSIGIISSILCNST
RMYNGAITKRMVCAGSVNGGVDSCQGDSGGPLVCEVSGTWYLAGVTSWGIGCGQKNKPGV
YARVTEFTNWIYTQMEANS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgatgccgaatgtttatcctcaaacggatttcagagagaatccaccgccatac
tccgctgtgcagcctggcgatctaccatcttacaccagcattcagaacccaccgccccct
tacacaagttcaccaccacgttcccattatccaactgcacccccgacgtctgggaaccca
cctggggaatatcagccctattacatacctgtgtctgtcccagttacgtcttcgacagca
gtgacccatgctgcagtcagaccctgcaagcatttctcctgctcacgaaagaggaggtgt
atgggatggggcagctctacgagcctggtcttcggtctggtagccgttggcatttggctt
atatacacttatgttgacttcagcccaagttccgagccacaatgtccatccgaattcgtt
cattgtgatgggaaatccgaatgctcggatagaagcgatgaatttggatgtgtgcgattc
aaaaagactaccaacgagctagaggtgttctcgtggaaaacgaacagctggctgcccgtg
tgttacagcggctggagcaacgatctggcaagcacaacctgccagcaattagggttcact
ggatatttccaatcgagcaaaattagcagcaaccaaatctcaaccctgacggtcaactcc
acagcaaagccaggaagtaatatccaaaccatactaagcagtggggaccaatgtgccagc
agagaggttgttggactcaagtgcatcgactgcgggaaaagagtcaatccatcagaaaga
atagtgggagggacggcggctgagctgcagaagtggccttggcaagtgagtctgcacttt
ggctccagccatgtgtgcggaggaaccatcattgctcatgactggatcctcactgctgcc
cattgcttccttggcgacacggcattggaaccttcaaactggaaggtgtacgctggcatt
atctctcagagatttaaatacaatggtcagttaagagatatcagccagatcatcactcac
aaacagtacagcagatccaccaacgacaatgacatggctttgttaaagctgagtagacct
ctgactttcacagatagagtacagcctgcctgtctgccagcctataaccagcagttccca
gaaaacagcaggtgttggacaaccggattcggacacctgcaagatggtgcctcttccatt
tcagaatcgctccagcaagtctccattgggataatcagcagcattttatgtaacagtaca
agaatgtataatggagccatcaccaagaggatggtgtgcgcaggctcggtaaatggaggt
gtggattcctgccagggtgacagtggagggccattggtgtgtgaagtgtcggggacctgg
tacttggcaggtgttaccagctggggcattggctgcggccagaaaaataaaccaggggtt
tatgctcgagtgacagaattcaccaactggatctacacccaaatggaggcgaacagctag

DBGET integrated database retrieval system