KEGG   Callorhinchus milii (elephant shark): 103180388Help
Entry
103180388         CDS       T03088                                 

Gene name
lct
Definition
(RefSeq) lactase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00052  Galactose metabolism
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103180388 (lct)
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     103180388 (lct)
    3.2.1.108  lactase
     103180388 (lct)
Chaperones and folding catalysts [BR:cmk03110]
 Intramolecular chaperones
  Others
   103180388 (lct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Glyco_hydr_116N Phage_antiter_Q Pim
Motif
Other DBs
NCBI-GeneID: 103180388
NCBI-ProteinID: XP_007894400
LinkDB All DBs
Position
Un
AA seq 1898 aa AA seqDB search
MALCNIFLILFSLSLSNAYHKEIKLPPDLMVIAGPLTPALVQAWAKEEEIPQGTTFVIGL
KEEAKYFCQDPPPTHLKKHLSTLHHSGVSHYKVILSWSHIVPDGTSQKVDDRVVKCYANL
LDELKSAHLKPVVVLHDGGIPQALNSKFGDWEKEALVDSFADYAKFVFSTFEDKVETWIT
FNNPLEMMKGRSQSRQSDLNMEPSVALKNIILAHKKAYKIYHSKIPPTGGRVSVALNINN
MVSADSMSQAFQQVITEGMVDLIAVTVQNDCGQNLEVETSAKAKEDSLQEKLTKIQSPNT
LQILVFSLEFSRCSAGSQEHPKAEFDEILKAVTSGKLRIAGYDASKLLEYFPISHQETSS
DKESIVPSVEQKLGGQVAEKKNEDIQHTLSSYETVQQKFSKQTEKERDAFLYGTFCTGFL
WSTSTTSFKVEGGWAEQGKGESIWDRFAHTGKVDNNQSADVACDSFNKIDYDVYLMRGLR
SNSYKFSLSWPRIFPTGYRTKPNQKGIDYYNKLIDSLLESNIQPMVTLYHWDLPQALQDV
GGWQNESVIKAFADYADFCFTTFGDRVKHWITFDEPWVVSYAGYGTGEHAPGIRNLSTAS
YRVAHSIIKAHAKAWHLYNDTHRPQQRGQVGIALNSDWAEPSSPDDPADTMAANRYLQFM
LGWFAHPIFVNGDYPQALKSQIEKYNQECAPSPVQLPLFTEKEKQYIRGTSDFFGLSHYT
SRLISSATNKTHCVMEYNRIGDFSSQIHTSWPQTASPWIYVVPWGLRRLLNFVTHEYTGA
DIPIYITGHGVPTEYDSGDIINDTFRIEHTSAYINEALKAFITDGIDVRAFTVRSLIDSF
EGPQGYKQRFGLHYVKFEDSNRPRTPKESAYFYTKLIEHNGFVKKSSSNLIRVLTPENNF
ERLKVLSASEVPSMAKAVWEKFSGQDISERDTFEYGTFPENFAWGVSTSSYQIEGGWDAD
GKGLSIWDNFTHQPNTILNGDTGDIACDSYHKIDEDLYMLRALGVKHYRFSISWPRIFPN
GRIESLNPPGVDYYNKLIDGLLASDIKPMVTLYHWELPQALQDIGGWENEELIELFNAWA
DYCFKTFGDRVKFWITLNEPYVISWMGYGTDLFPPAVKRPGDVPYLVAHRLLKAHAKAYH
TYDDNYRSTQKGIISISLNSDWAEPKQKNEPREIAAADRYIQFQVGWFAHPIFKNGDYPD
VMKWQIGNRSDLQRLTTSRLPEFTKEEKSYIQGTADVFCLNTYTARIVRHRIRKLKPFSY
EYDSDTDSEVDPSWPTSAFERFRPVAWGLRRLLNWIKEEYNNPSIYVTENGVPTNYKSSV
DDTDRIFYYKTYINEALKAYKLDGVQLKGYTAWSLMDNFEWMNGYSLRFGLHHVDFTDPN
RPRTPKRSAHYYAEIIRDNGFPLRKEDEFLYGEFPKNFVWSAATAAYQIEGAWRDDGKGL
SIWDKYAHTPLKIGNDDTGDIACDSYHKIDEDVAILKQLKVNHYRFSLSWPRIFPDGTTR
FVNEAGLNYYVKLIDALLEANIKPQVTLYHWDLPQALQDVGGWENITTIDRFVEYANFCF
QKLGNKVKFWITLNEPYNTALLGYGYGTAAPGVGSRLGTAPYIVAHNLIKAHAEVWHLYN
ETYRAQQGGLISITINSDWTEPRNPYKQEDVDAARRHLMFYGGWFAYPIFKNGDYNEIMK
ARVKEKSLAQGLSKSRLPEFTESEKQRIKGTYDYMGFNHYTTVLAFNVNFGNAIPLYDGD
RGTGTTTDRSWLGSGSFWLKVTPWGFRKILNWIKEEFNNPPIYITENGISEHGDKGLDDT
WRINYHRSYINEVLKAINVDGIDIRGYTAWSLMDNFEWAMGYADRFGLFYVNHTDPSLPR
IPKASVKYYSSIIRCNGFPDPAMGPNPCLQSEDPAARP
NT seq 5697 nt NT seq  +upstreamnt  +downstreamnt
atggctctgtgcaacattttcttaattttgttttccttgagtctgtctaatgcatatcac
aaagaaataaaattacctcctgatttgatggtaattgccggccctttaacacctgcttta
gtgcaggcttgggcaaaagaagaagaaatcccccaaggaaccacctttgtgatcggtttg
aaagaagaggcaaaatacttttgccaagaccctcctccaactcatttaaagaaacatctt
tcaactctccatcacagcggagtatcccactacaaggtcatactctcttggtctcatatt
gtccctgacggcacatcacagaaggtagatgacagggttgtaaaatgttacgcaaacctt
ctagacgagttaaaatctgcacatctgaagcctgtggtggttctacatgatggtggcatt
ccacaagctctgaattcaaagttcggtgactgggaaaaagaggcacttgttgactcattt
gcagactatgcaaagtttgttttttcaacttttgaagacaaagttgaaacctggataaca
tttaacaatccgttggagatgatgaaaggaagatctcagtcaaggcaaagcgatctgaac
atggaaccttcagtagctttaaagaacataatccttgctcacaaaaaggcttacaagatt
tatcacagcaaaataccacctacaggtggaagagtatctgttgctctgaacattaataac
atggtttcagcagacagcatgtcccaggcatttcaacaagttatcactgagggaatggta
gacttgattgctgtaactgtacaaaacgattgtgggcaaaatcttgaggtggagacttca
gcaaaggcaaaagaagattccttacaggaaaagctgacaaaaatccagagtcccaacact
ttacagattctggttttcagcttagagttttcgagatgttctgcaggctctcaagagcat
ccaaaagctgaatttgatgaaattctgaaagctgtaacttcggggaagttgcggattgca
ggctatgatgcaagcaaactcttggagtatttccccatttcccaccaagaaacctcctca
gataaagaaagcatcgttccttctgtggaacaaaagctgggagggcaggttgctgagaag
aagaatgaagacatccaacataccctttcatcttatgaaaccgtgcagcagaagttttcc
aaacaaacagagaaggagagggacgcctttctgtacggcactttctgcaccggttttctc
tggagcacatctactacatcatttaaggttgaggggggctgggcggaacaagggaaggga
gagagcatttgggacagatttgctcatacgggcaaagtagataacaaccagtctgcagac
gtggcctgcgacagcttcaacaaaatcgactatgatgtctacttaatgagaggattacga
tccaactcttacaagttctctttgtcatggccgagaattttccccacaggctatcgtacc
aaaccgaaccaaaaggggatagactactacaataaattaattgacagtctgctggagtcc
aacattcaacccatggtcaccctgtatcactgggatcttccgcaagctctgcaggatgtg
gggggttggcagaatgagagtgtaatcaaagcttttgctgactatgcagatttctgcttc
accacctttggggatcgcgtgaagcactggatcacatttgatgaaccctgggtggttagt
tacgctggatatggcacaggagagcacgcacctgggatcaggaatctgtccacagcatcg
tacagggtggcccattccatcatcaaagctcatgccaaggcctggcacctttataacgac
acccatcgtcctcagcagcgcggtcaagtggggatagcattaaattcagactgggctgag
ccaagctcccctgatgatccagcagacaccatggcagctaatcgctacctacagtttatg
ctgggctggtttgctcacccaatctttgttaatggtgattaccctcaagctttaaaatcc
caaatcgagaaatataaccaggaatgtgctccttcccccgtccaactcccattatttaca
gagaaggagaagcagtacatacgaggaacctctgacttttttggtctcagtcattacact
tctcgactgatcagttctgccactaacaaaacacattgtgtcatggaatacaatcgcatt
ggggacttctcttcacagatacacacttcatggcctcagactgcatccccgtggatatac
gttgtaccctgggggctgagaaggttgttaaactttgttacccacgaatatactggtgct
gacattccaatttacataacaggacatggagtgccgacagaatatgacagcggtgacatt
atcaatgatacctttaggatagagcacacttcggcctacattaatgaggcattgaaagct
ttcattaccgatggaatagatgtcagggcatttacggtaaggtcattaattgacagcttt
gaaggtccacaaggatataagcagaggtttggattacattatgtcaagtttgaagattcc
aacaggcccagaactccaaaggaatctgcctacttctacacaaaactgattgaacataat
ggctttgttaaaaaatcctcaagcaacttaattagagtcttgacacccgagaacaacttt
gagagattgaaggttttgtcagcatctgaagtcccttcaatggccaaagctgtgtgggag
aagttttcagggcaggacatttcggaaagggacacgtttgaatatggtacattcccagaa
aattttgcatggggtgtatccacctcatcatatcagatcgaaggagggtgggatgctgat
ggaaaaggacttagtatctgggacaacttcactcatcaacctaatacgattttgaatggt
gacacgggagatattgcatgtgatagttaccacaaaattgatgaagatctctacatgctt
cgagccttgggagtgaagcactaccggttttctatatcatggcctcgtatttttccaaat
gggagaatcgagtccctgaatcctccaggtgttgattattacaacaagttgattgatggc
ctgcttgcaagtgacataaagccaatggtgacactttaccactgggagctgcctcaggca
ctgcaagatattggcggctgggagaacgaagaattgattgaattgtttaacgcctgggca
gattattgcttcaaaacttttggagatagagtgaagttttggatcaccttaaatgaaccc
tatgtaatcagctggatgggatatggcacagatctatttcctcctgctgttaaaagacca
ggcgatgtcccatacttagtggcacacagattattgaaagctcatgccaaagcttatcac
acgtacgatgataattaccggagcacacagaaaggcataatttccattagtcttaattca
gattgggctgaacctaaacaaaagaatgaacccagagaaatcgctgccgctgatcgttac
attcagtttcaagttggctggtttgcacaccccatttttaaaaacggcgattatccagat
gttatgaaatggcagattggaaacaggagtgatttgcaacgcctaacaacttcgaggctt
cccgagtttacaaaggaagagaagagttatattcaaggcactgctgatgtgttttgcctc
aatacgtacactgcaagaattgtacgccatcgcatcagaaaactcaaacctttttcttat
gaatacgacagtgatacagattcagaggtggacccaagttggccaacttcagcttttgaa
cgctttaggcctgtggcatggggcctaaggagactattgaattggataaaagaagaatac
aacaacccttccatttatgtcactgaaaacggggtaccaacaaattacaagtccagtgta
gatgatacagacagaatattctactacaaaacatacatcaatgaagctttaaaagcctac
aaattggatggcgttcagctcaaaggttacacagcctggtccctcatggataactttgaa
tggatgaatgggtacagcttgcggtttgggctccaccatgtagacttcacagatcctaat
agaccaagaacacccaagcgttcagcacattattatgcagagatcattcgtgacaatggt
tttccgttacgaaaagaagatgaatttctgtatggagaattcccaaagaactttgtttgg
agtgcagctactgctgcctatcagattgaaggagcttggcgggatgacggaaaggggctc
agtatatgggacaagtacgctcatactcctttgaaaatcggcaatgatgacaccggagac
atcgcatgtgacagctatcacaaaattgatgaagatgtagcgatcctgaaacagctgaaa
gtcaaccattatcgcttttccttatcatggcctcgcattttcccagatggaaccacacgt
tttgtgaacgaagccggattaaactactatgtaaagttaattgatgctcttcttgaggct
aatatcaaacctcaggttaccctctatcactgggatctgcctcaggctctgcaggatgtt
ggtggctgggaaaatattactacaattgatcgatttgtagaatatgcaaacttctgcttt
cagaagttaggtaataaagtgaagttctggataaccttgaacgagccttataacaccgca
ctccttggttatggatatggcacagctgctccaggtgttggttcaagattaggcacagct
ccttatattgttgctcacaatctaatcaaggctcatgcagaggtttggcatctatataat
gaaacttacagagcacagcaaggcggtttgatctccattactatcaactcagactggact
gaaccaagaaacccttacaaacaagaggatgttgatgctgcaagaaggcatttaatgttt
tatggtggatggtttgcatatccaatcttcaaaaatggcgattacaatgagataatgaaa
gcgcgtgtgaaagagaagagtttggctcaaggcttaagtaaatctcgactccctgaattc
actgaatctgaaaaacagagaattaaagggacttacgactatatggggtttaatcactac
accacagtcttggcattcaatgtcaactttggaaacgccataccattgtatgatggagac
agaggaacagggacaacgacagaccgcagctggcttggttctggatcattctggctgaaa
gtaactccttgggggtttaggaaaattcttaattggattaaagaagagttcaacaacccg
cctatttatatcacggaaaatggcatctcagagcatggcgataaaggcctggatgatact
tggagaataaattatcatcggagttatataaatgaagttttgaaagctatcaatgttgat
ggaatcgatatccgtggctacaccgcatggtcattaatggacaactttgaatgggcgatg
ggctacgctgatagatttggtttattctacgttaatcataccgacccttcattacctcgc
attcctaaagcttctgttaagtattattcttcgatcattcgctgcaatggcttccctgat
cctgcaatgggacccaacccatgtctacagtcagaagatcctgctgcaagaccttga

DBGET integrated database retrieval system