KEGG   Callorhinchus milii (elephant shark): 103180851Help
Entry
103180851         CDS       T03088                                 

Gene name
pten
Definition
(RefSeq) phosphatase and tensin homolog
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00562  Inositol phosphate metabolism
cmk01100  Metabolic pathways
cmk04068  FoxO signaling pathway
cmk04070  Phosphatidylinositol signaling system
cmk04115  p53 signaling pathway
cmk04140  Autophagy - animal
cmk04150  mTOR signaling pathway
cmk04218  Cellular senescence
cmk04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103180851 (pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103180851 (pten)
   04070 Phosphatidylinositol signaling system
    103180851 (pten)
   04150 mTOR signaling pathway
    103180851 (pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103180851 (pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    103180851 (pten)
   04218 Cellular senescence
    103180851 (pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103180851 (pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cmk01009]
    103180851 (pten)
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103180851 (pten)
    3.1.3.48  protein-tyrosine-phosphatase
     103180851 (pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     103180851 (pten)
Protein phosphatases and associated proteins [BR:cmk01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    103180851 (pten)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc PTPlike_phytase Y_phosphatase Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 103180851
NCBI-ProteinID: XP_007895108
UniProt: V9KSZ3
LinkDB All DBs
Position
Un
AA seq 406 aa AA seqDB search
MASRIKELVSRNKRRFQEDGFDLDLTYIYPNIIAMGFPADRLEGVYRNNIDDVVKFLDAK
HKNHYKIYNLCAERHYDATKFNCRVAQYPFEDHNPPQLELIKPFCEDLDNWLSEDDNNVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGQARTIDKKGVTIPSQRRYVHYYSY
LLKHKLEYKPVALLFHKMRFETVPMFSGGTCNPMFVVSQLKVKIYTSPLGPTRREEKYMY
FEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWINTFFIPPPNENLDKVENGSIVTEKE
GDNWCYGTERTDNDKEYLALTLTKNELDKANKDKANRYFSPNFKVKLLFTKTVEERQPHP
LGNSSTTVTPDVSDNEPEDYRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgagaattaaagaacttgtcagcagaaacaagaggagattccaggaagatgga
ttcgacttggacttgacgtatatttatccaaacatcattgccatggggtttccagcggat
agacttgaaggtgtctacagaaacaacattgatgacgtagtgaaattcctggatgcaaaa
cataaaaaccattacaagatatacaacctatgtgcagaaagacattatgatgctactaaa
tttaattgccgagtcgcacagtatccttttgaagaccacaatccaccacagctagaactc
atcaagccattttgtgaggatctagacaactggctgagtgaagatgataacaatgttgca
gcaatccattgcaaagctggaaagggacgaacaggtgtaatgatctgtgcttatttgcta
catcgaggcaaatttcttaaagcacaagaagccctagatttctacggccaagcaaggacc
atagataagaagggtgtaacgattcccagccagaggcgttatgtacattattacagctac
cttttgaagcacaaattggaatacaaaccagtggcattactgtttcacaagatgcggttt
gaaactgttccaatgttcagtggtggaacatgtaatcctatgtttgtggtatctcagctg
aaggtgaagatctacacttcccctttgggaccgaccagacgtgaagaaaagtacatgtat
tttgaatttcctcagcccttgccagtatgtggagatattaaagtggaattcttccacaaa
cagaacaagatgatgaaaaaggataaaatgttccatttctggataaatacgttcttcatc
ccaccaccaaatgagaatttagataaggtagaaaatggcagcatagttacagaaaaggaa
ggtgacaattggtgctatggtacagagcgtacagataatgacaaggaatatctggccctt
acattgactaaaaatgaacttgacaaggcaaataaagacaaagccaacagatatttttca
ccaaatttcaaggtgaagctgttattcacaaaaacagtagaggaacgacaaccacatcct
ttgggcaacagttcaacgacagtaacgccggatgttagtgataatgaaccagaggactat
agatactcagacaccactgactctgacccagagaacgaaccttttgatgaagatcagcat
acgcagataacaaaagtctga

DBGET integrated database retrieval system