KEGG   Callorhinchus milii (elephant shark): 103181549Help
Entry
103181549         CDS       T03088                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00020  Citrate cycle (TCA cycle)
cmk00190  Oxidative phosphorylation
cmk01100  Metabolic pathways
cmk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103181549 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103181549 (sdha)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103181549 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 103181549
NCBI-ProteinID: XP_007896310
LinkDB All DBs
Position
Un
AA seq 658 aa AA seqDB search
MAPIFGVTLSRCLRKIPAACRTGVRNFHFAVYGKQNKKTATVSDAVSTQYPVVDHEFDAV
VVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALGNMESDDWRWHFYD
TVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEAGKIYQRAFGGQSLQFGKGGQ
AHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEGGECRGVIALCMEDGSIH
RFRANNTVIATGGYGRAYFSCTSAHTNTGDGVAMVTRAGLPNQDLEFVQFHPTGIYGAGC
LITEGCRGEGGILINSEGERFMERYAPVAKDLASRDVVSRSMTIEMREGRGCGPDKDHVY
LQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQAIKQV
NGKDEVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALSITEACKPGEAIPPIN
PSSGEESVANLDKLRFANGSIRTSELRMNMQKCMQSHAAVFRTGPVLKEGCEQLSSLYNS
LDDLKTFDRGIVWNTDLIETLELQNLMLCAMQTINGAEARKESRGAHAREDFKTRIDEFD
FSKPVKGQVEKTFSEHWRKHTLSTMDPKTGKVTLGYRPVIDTTLNEDCSSVPPAIRSY
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccatattcggagtgaccctgagccggtgtctgagaaagatccccgcagcttgt
cgaactggagttcgcaacttccactttgctgtctatggaaagcaaaacaagaaaaccgcc
acagtttcagatgcagtctcaactcagtaccctgtggtcgatcatgagtttgatgctgtt
gttgttggagcaggtggagctggcttgcgagcagctttcggtttatccgaggctggcttt
aacactgcatgtattacaaaactctttcctacaagatcacacaccgtcgcagcacagggt
ggaataaatgctgccctgggtaatatggagagtgatgattggagatggcatttctacgac
acagtgaagggatccgactggctgggagatcaagatgcgattcactacatgactgagcag
gcaccagcagctgttattgagttggaaaattatggtatgccattcagcagaactgaggct
gggaagatttatcagcgtgcatttggtggacagagtctgcagtttggaaaaggaggccaa
gctcatcgttgctgttgtgttgcagaccgaactggtcactccttgttgcacacattgtat
ggccggtcactgaggtatgacaccagctactttgttgaatactttgccctggatctcctg
atggaaggtggagaatgtcgaggtgtgattgcactgtgtatggaggatggttctattcat
cgctttagggccaataacactgtaattgctactggtgggtatgggagagcctacttcagc
tgtacttcagcacatacaaacactggagatggagtggccatggtcactagagctgggctg
cccaaccaggatttggagtttgtccagttccacccaacaggaatctacggtgccggttgc
cttattactgaaggctgtcgtggtgaaggtggaattctcatcaacagtgagggagagaga
ttcatggaacgctatgctcctgttgccaaagatcttgcttcaagagatgtggtttcacgt
tcgatgaccattgaaatgcgtgaaggacgtggctgtggccccgataaggaccatgtgtac
ctacagctgcaccatttgccaccccaacagctggctacacgtcttcctggtatttcagag
accgccatgatttttgctggagtcgatgtcactaaagagcccattccagttcttcccacc
gtgcattacaatatggggggtatccccactaactacaaaggacaggctattaagcaagta
aacggtaaagatgaagtggtgcctggtctctatgcctgtggtgaggctgctagtgcttct
gttcatggggctaatcgacttggtgcaaactctcttctcgacttggtggtgtttggtcga
gcctgtgctctatccatcactgaagcctgcaaacctggtgaggctattccaccaatcaat
ccaagttctggagaggaatcggtggctaacctcgataaattgcgatttgctaatggaagt
attcgaacgtcagaacttagaatgaatatgcaaaagtgcatgcagagccacgcagctgta
ttccgtactggtccagtgttgaaggaaggatgtgaacaattgagcagtctgtacaattct
ttggatgatctcaagacatttgacagaggcattgtgtggaacactgacctgatagagacc
ttggagctgcagaacttgatgctttgtgccatgcagactatcaatggtgctgaggctcgc
aaagagagcagaggagcacatgccagggaggatttcaagacgaggatagatgaatttgat
ttttccaaacccgtgaagggccaagttgaaaaaacatttagtgaacactggagaaagcac
acgctctctactatggatcctaagactggaaaggttacccttggctatagacctgtaatc
gacaccactttgaatgaagactgctcctccgtccccccagcaattcgctcttactaa

DBGET integrated database retrieval system