KEGG   Callorhinchus milii (elephant shark): 103182361Help
Entry
103182361         CDS       T03088                                 

Gene name
aldh7a1, antiquitin
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00010  Glycolysis / Gluconeogenesis
cmk00053  Ascorbate and aldarate metabolism
cmk00071  Fatty acid degradation
cmk00260  Glycine, serine and threonine metabolism
cmk00280  Valine, leucine and isoleucine degradation
cmk00310  Lysine degradation
cmk00330  Arginine and proline metabolism
cmk00340  Histidine metabolism
cmk00380  Tryptophan metabolism
cmk00410  beta-Alanine metabolism
cmk00561  Glycerolipid metabolism
cmk00620  Pyruvate metabolism
cmk01100  Metabolic pathways
Module
cmk_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103182361 (aldh7a1)
   00053 Ascorbate and aldarate metabolism
    103182361 (aldh7a1)
   00620 Pyruvate metabolism
    103182361 (aldh7a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103182361 (aldh7a1)
   00561 Glycerolipid metabolism
    103182361 (aldh7a1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    103182361 (aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    103182361 (aldh7a1)
   00310 Lysine degradation
    103182361 (aldh7a1)
   00330 Arginine and proline metabolism
    103182361 (aldh7a1)
   00340 Histidine metabolism
    103182361 (aldh7a1)
   00380 Tryptophan metabolism
    103182361 (aldh7a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103182361 (aldh7a1)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103182361 (aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     103182361 (aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     103182361 (aldh7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 103182361
NCBI-ProteinID: XP_007897548
LinkDB All DBs
Position
Un
AA seq 575 aa AA seqDB search
MAFQGAAPGFTNHNATRWRIPFPIARALALHCVASMLLQLVYPLARALLGRRRRTFCASR
HSAAMSTLLIQQPGYAWLRELGLREDNLGVFNGTWAGRGEIVTSYCPSNNEPIARVKQAS
LEDYEETVQKAKEAWKIWADIPAPKRGEIVRQIGDALRKKLKVLGNLVSLEMGKISIEGV
GEVQEYIDICDYAVGLSRMFGGPMLPSERPGHALIEQWNPLGLVGIITAFNFPVAVYGWN
NALALVCGNCCLWKGAPTTPLTSVAVTQIIAKVLEDNKLPGAICSLTCAGADVGAAMSKD
ERLDLLSFTGSTNVGNQVAVDIQKRFGRKLLELGGNNAIIVFDDADLNMVVPSVLFAAVG
TAGQRCTTTRRLLLHESVHDEVVTRLTKAYKQIRVGDPLESNTLYGPLHTKQSVDMYLAA
VGQAKQQGGNVVCGGKVINRPGNYVEPTIVTGLAHNAAIVHTETFAPILYVLKFKSEEEA
FAWNNEVKQGLSSSIFTKDVGRMFRWMGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGG
GRESGSDAWKHYMRRSTCTINYSKELPLAQGIKFE
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggccttccagggggcagcgccggggtttaccaaccacaacgcaacgaggtggagaatt
cccttccccatcgctcgggctctggcacttcactgcgttgcatccatgttgctgcagctc
gtgtatccgctcgccagggctctgctggggaggaggaggaggaccttctgcgcctccagg
cactcggctgccatgtccacgttgctgatccagcagcccggctatgcctggctccgggag
ctggggctgagggaggacaacctgggggtcttcaacgggacctgggctggcagaggggag
attgtcacctcttactgcccttcaaacaatgaaccgatagcacgagtcaaacaggccagt
ttagaagattatgaggagactgtgcagaaagctaaagaagcctggaaaatatgggctgat
attccagcacccaaacgtggagaaattgtgagacaaattggagatgctttaagaaagaag
cttaaagtcctgggcaacttggtttctctggagatgggcaagatttcaattgagggtgta
ggagaggtgcaggagtacatagatatctgtgactacgctgtgggactctctcggatgttt
ggggggcctatgctgccatctgagcgccctggccatgctctcatagaacagtggaatcca
cttggccttgtgggaatcatcactgcgttcaacttccctgtggcggtttatggctggaat
aacgctcttgcactcgtctgtgggaactgttgcctttggaaaggggctcctactacacct
ctgaccagcgttgcagtcacacaaatcattgcaaaagttttagaagacaacaaactacca
ggtgctatttgttccctaacctgtgccggagctgatgttggtgctgcgatgagcaaagac
gagaggctggacctgctctccttcactggcagcaccaatgtgggaaatcaagtagctgta
gacattcaaaagcgatttggacgaaagcttctggagcttggtgggaacaatgcaatcatt
gtgtttgatgatgctgatctaaacatggtggttccgtccgtcctgtttgccgctgtgggc
actgcgggacagagatgcacaaccaccagacgcctgctattgcacgagagtgttcacgat
gaagtggtcacgagactcaccaaggcttacaaacagatccgcgtcggagatcctttggaa
tctaatactttatacggtcccctccacaccaagcagtctgtggacatgtatttggctgca
gttggacaggccaaacagcaaggtggtaacgtggtttgtggtggaaaggtgatcaatcgc
ccaggaaactatgtggagccaaccattgtaaccggccttgcccacaatgcagccatcgtt
cacactgaaacattcgctcccattctgtatgtgcttaaattcaagtctgaggaggaagca
ttcgcctggaacaatgaggtcaagcaggggctttccagcagcatcttcaccaaggacgtg
ggtcgcatgttccgttggatgggacccaaaggttcagattgtggaattgttaacgtaaac
atcccgaccagtggtgctgaaatcggaggagcttttggtggagaaaaacacactggtggc
ggaagggagtctggcagtgatgcttggaaacactacatgagaaggtctacttgcaccatc
aactacagcaaggagctccctctggctcaaggaatcaaatttgaataa

DBGET integrated database retrieval system