KEGG   Callorhinchus milii (elephant shark): 103182663Help
Entry
103182663         CDS       T03088                                 

Gene name
ret
Definition
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmk01001]
    103182663 (ret)
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103182663 (ret)
Protein kinases [BR:cmk01001]
 Receptor tyrosine kinases (RTK)
  RET family
   103182663 (ret)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RET_CLD1 RET_CLD3 RET_CLD4 Cadherin RIO1 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 103182663
NCBI-ProteinID: XP_007897926
LinkDB All DBs
Position
Un
AA seq 1128 aa AA seqDB search
MGRMASFGAVNFDGFMVLSINCPHIEFHRSDQIKVLIWYNRVVGMALGLYFPRKTYQATV
HVGQPADTPLLQIYALPEEEDTAVYFGFCYNPLLIGLREHWFRIDEKSGVFYLNKTLEEN
DLSLLGNMGGPDLFKVIVHIFVSPKPFVEMECKAQVIIIVVNKVMPPCANITIEDLCFGE
MDSKVQIIENKYPGLFFQMRSLPNQFQCQPGNISYHLTTDGSFPFRINEETSELSVERSL
DREVMETYEMIVKCTWRKEFQVVHIERALHVTVLDKGDNPPFLLDGNDTVEAVIEFNRNE
HNVVATILVYDADSTTQYMTTIMKNDTWITENFRVEHRPFEIPATQESPARGTINKYELI
LKKNLSLSENRSFSLDVLVHDTEYQGSESTVTLHFNITIRLIIIEFSEETIHFTCNRNAG
RFAKIGRICIANCHKFQALNLTYTLMPVIHAEENGNATQVDRSCFSLVGVVKQPEDIFGI
LYISESKVLRWNNCSKLHFTVIANELLSKEETKTNMVVTLEGTHTHVRRHNCGKHCAEHK
LRSVCEECSGIGTQDGKCQWRQGYDKGISKNYSTCSSDLTTCPDKYCDIVEQKRSTCPQD
CIVRKKIVGGFELGEVRGIEGGFGTCYCNSGKCFCQKEDVIESTCDDVCKTIIAAAVLLS
FILSVLLSSYFIHRYHKNSPKAPIASAEMTFRRPAQAYPISYSSNNVRRPSVDSMENQVA
VDTFKIPEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENAS
QSELRDLLSEFNLLKQVSHPHIIKLYGACTQDGPLYLIVEYAKYGSLRNFLRESRKVGTS
YLGEGNRNSSYLDNPDERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGR
KMKISDFGLSRDVYEEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGILLWETVT
LGGNPYPGIAPERLFNLLKTGYRMERPENCSEEMYNLMLRCWKQEPDKRPTFAEISKELE
KMMVKSRDYLDLAASTPSDSLLYDDGLAEEETPLVDCNNAPLPRSLPSTWIENKLYGISY
PSWPEDNPIPITRFDGTNSVFTRYANDSVYANWMVSPSTAKFVEHYDS
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atgggccgaatggcttccttcggtgcagtaaatttcgatggtttcatggttctatccatt
aattgcccacacatagaattccacagatcggatcaaataaaggtgctgatctggtacaat
agagttgtgggaatggcccttggtctgtacttccccagaaagacataccaagcaactgtg
catgttggccagccagcagatacccctctcctgcagatttatgccttacctgaggaagag
gatactgctgtttattttgggttctgctacaatccactgctcattggattacgtgagcac
tggttccgaattgatgagaaatctggagtcttctaccttaataaaaccctagaagaaaat
gacctcagtctactaggtaacatgggtggccctgacttatttaaggttatagtgcacatc
tttgtctctcccaaaccatttgtggagatggagtgcaaggcacaggtgataattattgtg
gtgaataaggtcatgcctccctgtgcaaatatcaccattgaagatctgtgttttggagaa
atggattcaaaggttcaaattatagagaacaagtaccctggcctgttctttcaaatgaga
tccctgccaaaccagttccagtgccaaccgggcaacatctcctaccatctaacaacagat
ggttcatttccattcagaattaatgaggagacgtcagagctcagtgtggagcgttcactt
gacagggaggtgatggaaacatatgaaatgattgtaaaatgtacatggcggaaggaattc
caggtggttcacattgagagagccttgcatgtgactgtgcttgataaaggtgacaaccct
ccatttctccttgatggcaacgacacggtggaggctgtcattgaattcaacaggaacgag
cacaatgtcgtggccacaatcctggtgtatgatgctgacagtaccactcaatacatgacg
acaatcatgaaaaatgatacttggattacagaaaacttcagagtggaacatagacctttc
gaaattcctgccactcaagagagccctgctcgagggacaataaacaaatatgagctgata
ctgaagaaaaacctgtctctttctgagaaccgatcattcagtttggacgtccttgtgcat
gacacagaataccaaggctctgagagcactgtcacacttcacttcaatatcactatccgg
ctaatcatcattgagttttctgaagaaacgatccacttcacatgtaataggaatgcagga
cgttttgcaaagattggaagaatttgcatagcaaactgtcacaagtttcaagccttaaat
ctaacttatacattaatgccggtgatccatgcagaagagaatgggaatgccacacaggtg
gacagaagctgcttttccctggttggggttgtgaagcaacctgaggatatatttggaatc
ctgtacatttctgaatctaaagtgctgagatggaacaactgcagcaaacttcactttacc
gtcatagctaatgaattactgagcaaggaggagacaaagaccaacatggttgttacgttg
gagggaacacatactcatgttagaaggcataactgtggcaaacactgtgctgagcacaag
ttgcgatcagtctgtgaagaatgtagcggtattggaacccaagatggaaagtgccagtgg
cggcaggggtatgataaaggcatatcaaaaaactactccacctgctcatcagatcttacc
acatgtcctgataaatactgtgatatagtggagcagaagaggagtacgtgcccacaagat
tgtattgttcggaagaaaattgttggcggatttgaattaggagaggtgagaggaatcgaa
ggaggatttgggacgtgttattgcaattctggcaaatgtttctgccaaaaggaagatgtc
atagaatcgacttgcgacgatgtctgtaaaaccatcattgctgcggccgtgctgctgtca
ttcatcctgtccgtactgctctcttcatacttcatccaccgataccacaagaattctccc
aaagctcctattgcctcagcagagatgactttcaggaggccagctcaagcctaccccatc
agctactcctccaataatgtccggaggccctctgtggattccatggagaatcaagtggca
gtggacaccttcaaaataccagaggatcccaaatgggagtttccaaggaagaatctagtc
cttggcaaaaccctcggtgaaggagaatttgggaaagtcgtgaaggctactgcgttcaga
ctaaaggggaaagcaggctacaccaccgttgccgtcaagatgctgaaagagaatgcttct
caaagtgaactgcgagatctcttatcggagttcaacttactgaaacaagtcagccacccc
cacattattaaactctatggagcatgcactcaagatggtcctctatatctcattgtggaa
tacgctaaatatggatccctgagaaacttcctgagagaaagtcgcaaagtaggcaccagt
tacctgggggaagggaaccgaaattctagttacttggacaatccagatgaacgggctttg
accatgggagatttgatatcgtttgcctggcagatctcccggggaatgcaatacctggct
gaaatgaagcttgtccaccgtgatttggcagcacgaaatgttctggttgctgaaggacgt
aagatgaagatctcagactttggcctctccagagatgtgtatgaggaagactcttatgta
aagagaagcaagggtcgaattcctgtcaagtggatggcaatcgaatcactgtttgatcac
atctataccacccagagtgatgtgtggtcatttggcattcttctttgggagacagtgaca
ttgggtggaaacccatatcctggcattgctcctgaacgcctcttcaacctcttaaagaca
ggatatcggatggagcgaccagaaaattgcagtgaggaaatgtacaacttgatgctgcga
tgttggaaacaagagccagataaacgacctacctttgcagaaatcagcaaagagctggag
aaaatgatggtgaagagtcgagactacctggatctggcagcctccacaccatcagactct
ctgctgtatgacgatgggctggctgaagaagagacgccactggtagactgtaataatgct
cccctccctcggtccctcccctccacatggattgaaaacaaactctacggcatctcgtat
cccagctggcctgaagacaaccccattcccataacaagattcgatggaactaactctgtc
tttacaagatatgcaaatgatagtgtttatgcaaactggatggtgtcaccttcaacagca
aaatttgtggaacactatgatagttaa

DBGET integrated database retrieval system