KEGG   Callorhinchus milii (elephant shark): 103183003Help
Entry
103183003         CDS       T03088                                 

Definition
(RefSeq) complement component C8 gamma chain-like
  KO
K03999  complement component 8 subunit gamma
Organism
cmk  Callorhinchus milii (elephant shark)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin ToxS
Motif
Other DBs
NCBI-GeneID: 103183003
NCBI-ProteinID: NP_001279590
UniProt: K4FUM6
LinkDB All DBs
Position
Un
AA seq 200 aa AA seqDB search
MAGAHVIYFIVLCFLVISSGQRRRNVRKQASPIDGVQIQENFNIDQFSGKWYLIGVASHC
TYLRSSSYSVEAVVMQVSNEKETVRTNTLHKMEGICWDIKQEYKKTRTIGKFYRKKRGVT
TYMAVGETDYSKYAIIAVQQTPKQKLTLKLYGRSTELDENIQMKFRQHVIQHKIPEIFIY
EFPSYGHCQSADEFHRLDDS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtgctcatgtcatctacttcattgtcctttgctttctagttatctcatccgga
caaagacgcaggaacgtcagaaagcaggccagccccattgacggagtccaaatacaggaa
aactttaacattgaccagttttcaggcaaatggtatcttattggtgtggcgtctcattgt
acctatttgagatcgagcagctacagtgtggaagcagttgtcatgcaagtttccaatgag
aaagaaactgtgcgcaccaatacattgcataaaatggaaggaatatgttgggatatcaaa
caggagtacaagaagacaaggaccattgggaagttctaccgaaaaaaacggggagtgact
acttacatggcagttggtgaaactgattacagcaaatacgcaatcatcgctgttcagcag
actcccaaacagaagctgactctgaaactctatggaaggagcacagagttggatgagaat
atacaaatgaagtttcgccagcacgtgatccagcacaagatcccggaaatcttcatttac
gaattcccttcttatggccattgccagtcagcggatgaatttcacagactggacgacagt
taa

DBGET integrated database retrieval system