KEGG   Callorhinchus milii (elephant shark): 103183299
Entry
103183299         CDS       T03088                                 

Gene name
nos2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00220  Arginine biosynthesis
cmk00330  Arginine and proline metabolism
cmk01100  Metabolic pathways
cmk04020  Calcium signaling pathway
cmk04146  Peroxisome
cmk04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103183299 (nos2)
   00330 Arginine and proline metabolism
    103183299 (nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103183299 (nos2)
   04020 Calcium signaling pathway
    103183299 (nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103183299 (nos2)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     103183299 (nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 103183299
NCBI-ProteinID: XP_007898890
UniProt: V9K991
LinkDB
Position
Un
AA seq 1130 aa
MLCPWRFLQKNKYNVDLNNNDFEQEAEPSKLYTSSVPTSEVQKLQKIVNNEKCKHPEIEE
KPTQPTKVTSACPFAPKFVKLTYMGNGDTLQDTLHRKATVKMPCQSSACRGALMTPKAMT
RGPRDQAIPPEEILPLAIEFINQYYKSFKSPQVKEHLARVEEVSKEITDTGTYQLTTEEL
FYGAKQAWRNAPRCIGRIQWSNLKLFDARKCNSAQEMFDHICTHLRYASNDGNLRSTITV
FPQRTDGKHDFRVWNSQLVRYAGYQLEDGSIIGDPASIEFTKLCMMLGWTPRFERFEVLP
MVLQFNGEDPEIFEIPRDVILEVEMEHPRYDWFKDLGLRWYALPAVANMLLEVGGLEFPG
CPFNGWYMGSEIGVRDFCDIQRYNVLEQVGKKMGLDTRKLSNLWKDQAVVEINIAVLHSF
QKRNVTIMDHHTAAESFMKHMQNEFRLRGGCPADWVWIVPPISGSITPVFHQEMLNYILS
PFYYYQPDPWKTHVWHDESRRPQKNMIKFKHLAKAVLFTSALMRKTMAQRVKATILFATE
TGKSETFARKLCTMFNSAFNTKVMCMDDYELSDLAQESLVLVVASTFGNGDSPGNGERFK
KSLFTKKPAKLYNFRYSVFGLGSRMYPQFCAFAHAVDRKLQQLGAAQMSPTGEGDELSGQ
EESFIGWALNTFKTACNVFRVRGQVDLSQFKATTTSEVWEPSKYRLANIAQPMDLCAALS
KLHLKDVVPMTLKSRTNLQSAKSSRSTILVELSCGPSEELQYLPGEHIGVFPSNQAELVS
GLIKRLKDSPAPNQCVKVEVRGDKASDWTATERIPACTLSEALTHFLDITTPPAPQLLKK
VAQLATEESEKNRLLELSQNSQEYEKWRSFSSPTILELLQEFPSIQCTSTFLLTQLMLLK
PRYYSVSSSLDKSPRQIHLTVAVVNYRTKDGQGPLHHGVCTSWFNTMEMNEMVPCYVRST
AGFHLPKNPSKPCILIGPGTGIAPFRSFWQQRLHDFETQGTRACGMTLVFGCRHSEMDHI
YKEETQALKAKGILKDVYTAYSREPGTQKTYVQDILREKLASKVYSALHEEKGHIYICGE
IQMAQDVAETLKEVVAKQGNMSVEEAEEFLTELKNQKRYHEDIFGATFQK
NT seq 3393 nt   +upstreamnt  +downstreamnt
atgctgtgtccttggagattcctgcagaagaacaaatacaatgtggatctaaacaacaat
gacttcgagcaggaagccgagcccagcaagctctacacctcctctgttcctacctccgag
gtccaaaaactgcagaaaatagttaacaacgaaaaatgcaaacaccctgagatcgaggag
aaaccgactcagcccaccaaggtgaccagtgcatgcccattcgctccgaaattcgtgaag
ttaacctacatgggaaatggagacaccttacaggacaccttgcatcgcaaagcaacagtg
aaaatgccgtgtcagtcctcggcttgccgtggagcactcatgactcccaaagcaatgacc
cgagggcccagagatcaggctattccaccagaggaaatccttcctctggctatagaattc
atcaatcagtactacaagtctttcaagagcccccaggtcaaagaacatctggcccgggtg
gaggaggtgagcaaagagatcaccgataccggcacttaccagctgaccaccgaagagcta
ttttacggggccaagcaagcttggcgcaacgctccacggtgcattggccgtatccagtgg
tccaacctgaagctctttgatgctcgtaaatgcaactcagcacaggagatgttcgatcac
atctgcactcacttgcgatacgcatccaacgacgggaatctaagatctacgatcactgta
ttccctcaaaggacagatgggaagcacgacttcagggtgtggaactctcagctggtccga
tatgcaggttaccagctggaggatggttccatcatcggagatcctgccagcattgagttc
actaagttgtgcatgatgctgggctggactcctcgctttgaacgctttgaggtgctccca
atggtccttcagttcaacggggaggatccagaaatctttgaaatcccacgggatgtgatt
cttgaagtggaaatggaacatccaagatacgactggttcaaggatctcggccttaggtgg
tacgctctgcccgctgtggccaacatgttactggaagttggtgggctggagtttccaggc
tgcccattcaatggctggtatatgggctcggagattggcgttcgagatttctgtgacatc
cagcggtacaatgtgctggagcaagttgggaagaagatgggcttggacacaaggaaactg
agtaatctctggaaagatcaagctgtagtggagatcaacattgctgtcctgcacagcttc
cagaaaagaaatgttactattatggaccatcacactgcggctgagtccttcatgaagcac
atgcagaacgagttccgtctgagaggaggctgcccggccgactgggtgtggattgtgcct
cccatctccggcagcatcaccccagtcttccatcaggagatgctgaattacatcctctca
cccttctattactaccagccggacccctggaaaacccatgtgtggcacgacgagagccgt
agaccgcagaagaacatgatcaagtttaaacacttagccaaggctgttctgttcacctct
gctctgatgcgcaaaacaatggcacagagggtgaaagcgaccattctgttcgccacggaa
actggaaaatccgagacctttgccaggaagctctgcacaatgttcaacagcgctttcaac
accaaggttatgtgtatggatgactatgaactgagtgatttggcccaggagtccctggtg
ctggtggtggcaagtacctttggaaacggagattcacctggaaatggagagagatttaag
aaatccctgttcaccaagaaacctgcaaaactgtacaacttcaggtactcggtctttggc
cttggttcccgcatgtacccgcagttctgcgcctttgcccacgcagtggatagaaagctg
cagcagctgggagctgcccagatgtcaccaacgggtgaaggggacgagctcagcgggcaa
gaggaatccttcataggctgggctctgaacaccttcaagacggcatgcaatgtgttccgc
gtccgaggccaagtggatctcagtcagttcaaagcgaccaccacgagcgaggtgtgggag
cccagcaaatacaggctggcaaacatcgcccagcccatggatctgtgcgcagctctttcg
aaactgcatttgaaggacgtcgtgccaatgacgctgaaatcgaggaccaacctgcagagt
gcgaagtccagccgctccaccatcctggtcgagctctcctgtgggccctcggaggagctc
cagtatctgccaggagaacacattggcgttttcccatccaaccaggccgagctggtgagt
gggctcatcaagaggctcaaagactcgccggctcctaaccagtgtgtgaaggtggaggtc
cgtggggacaaagccagtgactggacggcaacggaaaggatcccagcctgcaccctctca
gaggcgctgacccacttcctggatatcaccacaccccccgccccgcagctcctgaagaaa
gtggcccagttggccacggaagaatccgagaagaacagactgctagagctgagccagaat
tcccaggagtacgagaagtggagatctttcagcagcccgaccatcctggagctcctgcag
gaattcccctccatccagtgcaccagcaccttcctcctcacccagctcatgctcctcaag
cccagatattactccgtcagctcctccctggacaagagtcccagacagatccacttgact
gtcgcagtggtgaactacaggacaaaagatggccaaggacccttgcatcatggagtctgc
accagttggttcaacaccatggaaatgaatgagatggtcccctgttacgtgcgcagcact
gcgggattccacctaccaaagaacccgtccaaaccctgcatcctgatcggccccggaaca
ggaattgctccgttcagaagcttctggcaacagcgattgcacgacttcgaaacacaagga
acccgagcctgtggcatgaccttggtgttcggttgccgccattccgaaatggatcacatt
tacaaggaagaaactcaggcgctcaaagccaaaggcatcctgaaggacgtttacacggcc
tattccagagaaccaggcacacagaagacctatgttcaggacatccttcgggagaagctg
gcttccaaggtctacagtgcgctgcacgaagaaaagggacacatttacatctgcggcgaa
atccaaatggcacaagatgtcgccgaaacactgaaggaggtggtcgccaagcagggaaac
atgagtgtggaggaggctgaggagttcctcaccgagctgaagaaccagaagagataccac
gaagacatcttcggcgcaacatttcagaaatag

DBGET integrated database retrieval system